SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene77898

Length: 283 nt

UniGene Fasta

>sp_v3.0_unigene77898
ATCCTTGTATACGAATACATGAAGAATGGGAGTTTGTGGGACAGACTGCATCAGACAACTGGTCCAATATTGGATTGGCAGACACGCTATAAAATAGCGCTTGGAATAGCTCATGGATTGGCTTATTTGCACAATGACTGCGTTCCTGCTATTGTCCACAGAGATGTCAAATCCAGTAATATACTGTTAGATGAAGATTGCGAGCCGCGCTTAGCTGATTTCGGAGTTGCAAAAATCATTCAATCCTGTGGAAGGGGAGACTCTACAGCTATTATTGCTGGCA

Ace file of the UniGene sp_v3.0_unigene77898

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	Clavata-like receptor n=1 Tax=Picea glauca RepID=Q19AV8_PICGL	-	-	1.0e-29	70%
FL-Next	tr=Clavata-like receptor; Picea glauca (White spruce) (Pinus glauca).	-	-	0.0	70%
Sma3	Leucine-rich repeat receptor-like protein kinase	-	-	1.14e-29	-

Source	ECs	Term	Type	e value	Identity
Sma3	2-alkenal reductase.	EC:1.3.1.74	-	1.314e-21	-
Sma3	Non-specific serine/threonine protein kinase.	EC:2.7.11.1	-	3.993e-07	-
Sma3	Mitogen-activated protein kinase kinase kinase.	EC:2.7.11.25	-	9.313e-17	-

Source	Gene names
Sma3	AT1G17750; AT1G28440; AT1G73080; AT1G75820; AT1G79620; AT2G26330; AT3G13380; AT3G49670; AT4G20140; AT4G28490; AT4g20140; AT5G07180; AT5G07280; AT5G48940; AT5G49660; AT5G61480; AT5G62230; AT5G65700; At1g09970; At1g09970/F21M12.36; At1g17750; At1g28440; At1

Source	GOs	Term	Type	Identity
Sma3	extracellular region	GO:0005576	Cellular Component	-
Sma3	cytoplasm	GO:0005737	Cellular Component	-
Sma3	mitochondrion	GO:0005739	Cellular Component	-
Sma3	plasma membrane	GO:0005886	Cellular Component	-
Sma3	integral to membrane	GO:0016021	Cellular Component	-
Sma3	aminopeptidase activity	GO:0004177	Molecular Function	-
Sma3	protein serine/threonine kinase activity	GO:0004674	Molecular Function	-
Sma3	protein tyrosine kinase activity	GO:0004713	Molecular Function	-
Sma3	receptor activity	GO:0004872	Molecular Function	-
Sma3	steroid binding	GO:0005496	Molecular Function	-
Sma3	protein binding	GO:0005515	Molecular Function	-
Sma3	ATP binding	GO:0005524	Molecular Function	-
Sma3	transmembrane receptor protein kinase activity	GO:0019199	Molecular Function	-
Sma3	identical protein binding	GO:0042802	Molecular Function	-
Sma3	protein phosphorylation	GO:0006468	Biological Process	-
Sma3	proteolysis	GO:0006508	Biological Process	-
Sma3	defense response	GO:0006952	Biological Process	-
Sma3	meiosis	GO:0007126	Biological Process	-
Sma3	epidermis development	GO:0008544	Biological Process	-
Sma3	embryo sac development	GO:0009553	Biological Process	-
Sma3	microsporogenesis	GO:0009556	Biological Process	-
Sma3	embryo development	GO:0009790	Biological Process	-
Sma3	regulation of meristem structural organization	GO:0009934	Biological Process	-
Sma3	leaf morphogenesis	GO:0009965	Biological Process	-
Sma3	regulation of meristem growth	GO:0010075	Biological Process	-
Sma3	stomatal complex morphogenesis	GO:0010103	Biological Process	-
Sma3	tapetal cell fate specification	GO:0010234	Biological Process	-
Sma3	microsporocyte differentiation	GO:0010480	Biological Process	-
Sma3	cell differentiation	GO:0030154	Biological Process	-
Sma3	regulation of cell adhesion	GO:0030155	Biological Process	-
Sma3	interspecies interaction between organisms	GO:0044419	Biological Process	-
Sma3	protein autophosphorylation	GO:0046777	Biological Process	-
Sma3	gametophyte development	GO:0048229	Biological Process	-
Sma3	ovule development	GO:0048481	Biological Process	-
Sma3	defense response to fungus	GO:0050832	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	Alpha/beta hydrolase fold-1	IPR000073	-	-
Sma3	Protein kinase, catalytic domain	IPR000719	-	-
Sma3	Serine-threonine/tyrosine-protein kinase catalytic domain	IPR001245	-	-
Sma3	Leucine-rich repeat	IPR001611	-	-
Sma3	Enolpyruvate transferase domain	IPR001986	-	-
Sma3	Peptidase S33	IPR002410	-	-
Sma3	Aminotransferases, class-I, pyridoxal-phosphate-binding site	IPR004838	-	-
Sma3	Proline iminopeptidase	IPR005944	-	-
Sma3	Phosphopantetheine attachment site	IPR006162	-	-
Sma3	Serine/threonine-protein kinase, active site	IPR008271	-	-
Sma3	Leucine-rich repeat-containing N-terminal, type 2	IPR013210	-	-
Sma3	NAD(P)-binding domain	IPR016040	-	-
Sma3	Protein kinase, ATP binding site	IPR017441	-	-
Sma3		IPR017442	-	-
Sma3	HTH domain AraC-type, conserved site	IPR018062	-	-
Sma3	Asp/Glu racemase, active site	IPR018187	-	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	AT5G49660.1	Leucine-rich repeat transmembrane protein kinase family protein chr5:20161401-20164534 REVERSE LENGTH=966	1.0e-31	55%
RefSeq	Arabidopsis thaliana	NP_199777.1	putative leucine-rich repeat transmembrane protein kinase [Arabidopsis thaliana]	1.0e-31	55%
RefSeq	Populus trichocarpa	XP_002305776.1	predicted protein [Populus trichocarpa]	2.0e-34	63%

Full-Lengther Next Prediction

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: Q19AV8

Fln msg: Distance to subject end: 137 aas, your sequence is shorter than subject: 94 - 998

Fln protein: ILVYEYMKNGSLWDRLHQTTGPILDWQTRYKIALGIAHGLAYLHNDCVPAIVHRDVKSSNILLDEDCEPRLADFGVAKIIQSCGRGDSTAIIAG

Protein Length: 95

Fln nts: ATCCTTGTATACGAATACATGAAGAATGGGAGTTTGTGGGACAGACTGCATCAGACAACTGGTCCAATATTGGATTGGCAGACACGCTATAAAATAGCGCTTGGAATAGCTCATGGATTGGCTTATTTGCACAATGACTGCGTTCCTGCTATTGTCCACAGAGATGTCAAATCCAGTAATATACTGTTAGATGAAGATTGCGAGCCGCGCTTAGCTGATTTCGGAGTTGCAAAAATCATTCAATCCTGTGGAAGGGGAGACTCTACAGCTATTATTGCTGGCA

Fln Alignment:

GD4IA4403HLH1B___ILVYEYMKNGSLWDRLHQTTGPILDWQTRYKIALGIAHGLAYLHNDCVPAIVHRDVKSSNILLDEDCEPRLADFGVAKIIQSCGRG-DSTAIIAG
Q19AV8_______________LLVYEYMPNGSLGDLLHGPKASVLDWPIRYKIALGAAQGLAYLHHGCVPAIVHRDVKSNNILLDEDYVAHVADFGVAKILQSCARGADSMSAIAG

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain