|
||||||
|
UniGene Name: sp_v3.0_unigene77883
Length: 243 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene77883
G |
|
Ace file of the UniGene sp_v3.0_unigene77883
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Peptide transporter PTR2 n=4 Tax=Brassicaceae RepID=PTR2_ARATH | - | - | 3.0e-12 | 47% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 81% |
| Source | Gene names |
|---|---|
| Sma3 | At2g02040; At3g54140; At5g01180; F14H20.11; F24B22.100; F7J8_160; LOC_Os10g02100; NTR1; OSJNBa0015O22.24; Os10g0109900; OsI_32529; OsI_32532; OsJ_30497; PHYPADRAFT_134814; POPTRDRAFT_762471; POPTRDRAFT_805077; PTR2; PTR2-B; RCOM_0098850; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | plant-type vacuole | GO:0000325 | Cellular Component | 0.0 | - |
| Sma3 | vacuolar membrane | GO:0005774 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | transporter activity | GO:0005215 | Molecular Function | 0.0 | - |
| Sma3 | high affinity oligopeptide transporter activity | GO:0015334 | Molecular Function | 0.0 | - |
| Sma3 | dipeptide transporter activity | GO:0042936 | Molecular Function | 0.0 | - |
| Sma3 | tripeptide transporter activity | GO:0042937 | Molecular Function | 0.0 | - |
| Sma3 | oligopeptide transport | GO:0006857 | Biological Process | 0.0 | - |
| Sma3 | protein transport | GO:0015031 | Biological Process | 0.0 | - |
| Sma3 | dipeptide transport | GO:0042938 | Biological Process | 0.0 | - |
| Sma3 | tripeptide transport | GO:0042939 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Oligopeptide transporter | IPR000109 | - | 0.0 | - |
| Sma3 | Aldehyde dehydrogenase, conserved site | IPR016160 | - | 0.0 | - |
| Sma3 | PTR2 family proton/oligopeptide symporter, conserved site | IPR018456 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT2G02040.1 | ATPTR2-B, NTR1, PTR2-B, PTR2, ATPTR2 peptide transporter 2 chr2:487542-489707 FORWARD LENGTH=585 | 1.0e-16 | 53% |
| RefSeq | Arabidopsis thaliana | NP_178313.1 | peptide transporter PTR2 [Arabidopsis thaliana] | 2.0e-16 | 53% |
| RefSeq | Populus trichocarpa | XP_002315835.1 | predicted protein [Populus trichocarpa] | 5.0e-16 | 52% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LQ68
Fln msg: Distance to subject end: 286 aas, your sequence is shorter than subject: 80 - 407
Fln protein:
G
Protein Length:
81
Fln nts:
G
Fln Alignment:
GD4IA4403GSXT0___GYGFGXXXXXXXXXXXXFLCGTPFYRHKLPGDSPITRIAQVVVAAIRKRNMSRPLDVSLLYENQDVEFIKS-----GQRHLSHTD
B8LQ68_______________GFGFGIVTVAMAIATVVFLYGTPFYRHKLPGGSPITSIAQVVVAAIRKRNISMPSDVSLLYEDRDVESIKSESIKPGQRHLSHTD
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
