UniGene Name: sp_v3.0_unigene77716
Length: 186 nt
UniGene Fasta |
---|
>sp_v3.0_unigene77716
G |
Ace file of the UniGene sp_v3.0_unigene77716 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Translationally-controlled tumor protein homolog n=4 Tax=Pinaceae RepID=TCTP_PSEMZ | - | - | 1.0e-16 | 95% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 95% |
Sma3 | Translationally-controlled tumor protein homolog | - | - | 0.0 | - |
Source | Gene names |
---|---|
Sma3 | At3g05540; At3g16640; F18C1.20; GSVIVT00019752001; GSVIVT00022381001; GSVIVT00022720001; MGL6.10; Os11g0660500; OsI_36917; OsJ_34729; PHYPADRAFT_205346; PHYPADRAFT_71619; POPTRDRAFT_725698; POPTRDRAFT_828031; POPTRDRAFT_828728; PnTCTP; RCOM_0681260; RCOM_ |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | thylakoid | GO:0009579 | Cellular Component | 0.0 | - |
Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
Sma3 | calcium ion binding | GO:0005509 | Molecular Function | 0.0 | - |
Sma3 | regulation of cell growth | GO:0001558 | Biological Process | 0.0 | - |
Sma3 | pollen tube growth | GO:0009860 | Biological Process | 0.0 | - |
Sma3 | auxin homeostasis | GO:0010252 | Biological Process | 0.0 | - |
Sma3 | defense response to bacterium | GO:0042742 | Biological Process | 0.0 | - |
Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
Sma3 | lateral root development | GO:0048527 | Biological Process | 0.0 | - |
Sma3 | root hair cell tip growth | GO:0048768 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | IPR001983 | - | 0.0 | - | |
Sma3 | Mss4/translationally controlled tumour-associated TCTP | IPR011323 | - | 0.0 | - |
Sma3 | Translationally controlled tumour protein, conserved site | IPR018103 | - | 0.0 | - |
Sma3 | Translationally controlled tumour protein | IPR018105 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT3G16640.1 | TCTP translationally controlled tumor protein chr3:5669709-5670729 REVERSE LENGTH=168 | 9.0e-20 | 76% |
RefSeq | Arabidopsis thaliana | NP_188286.1 | translationally-controlled tumor protein-like protein [Arabidopsis thaliana] | 1.0e-19 | 76% |
RefSeq | Populus trichocarpa | XP_002314382.1 | predicted protein [Populus trichocarpa] | 5.0e-20 | 83% |
Full-Lengther Next Prediction |
---|
Fln status: Putative C-terminus
Fln database: coniferopsida.fasta
Fln subject: A9NYF7
Fln msg: Unexpected stop codon in the beginning of your sequence, STOP codon was not found. Distance to subject end: 0 aas, your sequence is shorter than subject: 61 - 160
Fln protein:
G
Protein Length:
62
Fln nts:
G
Fln Alignment:
GD4IA4403FWTW4___LSDLQFFVGESMHDDGSMVFAYYKEGAADPTFLYFADGLKEVK
A9NYF7_______________LSDLQFFVGESMHDDGSMVFAYYKDGATDPTFLYFADGLKEVK
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain