UniGene Name: sp_v3.0_unigene77558
Length: 177 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene77558
G |
Ace file of the UniGene sp_v3.0_unigene77558
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Multidrug/pheromone exporter, MDR family, ABC transporter family n=3 Tax=Populus trichocarpa RepID=B9HAY0_POPTR | - | - | 3.0e-17 | 80% |
| FL-Next | tr=MDR-like ABC transporter; Taxus cuspidata (Japanese yew). | - | - | 0.0 | 51% |
| Sma3 | Multidrug/pheromone exporter, MDR family, ABC transporter family | - | - | 0.0 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Phosphate-transporting ATPase. | EC:3.6.3.27 | - | 1.715e-08 | - |
| Sma3 | Peptide-transporting ATPase. | EC:3.6.3.43 | - | 2.743e-08 | - |
| Sma3 | Xenobiotic-transporting ATPase. | EC:3.6.3.44 | - | 1.64e-36 | - |
| Source | Gene names |
|---|---|
| Sma3 | At1g10680; At1g27940; At1g28010; At2g36910; At2g39480; At3g28344; At3g28345; At3g28360; At3g28380; At3g28390; At3g28415; At3g28860; At3g55320; At4g01820; At4g01830; At4g18050; CMDR1; Cjmdr1; F12L6.14; F13K9.11; F13K9.5; F15J5.20; F20B24.12; GSVIVT00000633 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | auxin efflux transmembrane transporter activity | GO:0010329 | Molecular Function | 0.0 | - |
| Sma3 | ATPase activity | GO:0016887 | Molecular Function | 0.0 | - |
| Sma3 | ATPase activity, coupled to transmembrane movement of substances | GO:0042626 | Molecular Function | 0.0 | - |
| Sma3 | transport | GO:0006810 | Biological Process | 0.0 | - |
| Sma3 | regulation of cell size | GO:0008361 | Biological Process | 0.0 | - |
| Sma3 | response to blue light | GO:0009637 | Biological Process | 0.0 | - |
| Sma3 | photomorphogenesis | GO:0009640 | Biological Process | 0.0 | - |
| Sma3 | auxin mediated signaling pathway | GO:0009734 | Biological Process | 0.0 | - |
| Sma3 | positive gravitropism | GO:0009958 | Biological Process | 0.0 | - |
| Sma3 | response to far red light | GO:0010218 | Biological Process | 0.0 | - |
| Sma3 | basipetal auxin transport | GO:0010540 | Biological Process | 0.0 | - |
| Sma3 | acropetal auxin transport | GO:0010541 | Biological Process | 0.0 | - |
| Sma3 | anthocyanin accumulation in tissues in response to UV light | GO:0043481 | Biological Process | 0.0 | - |
| Sma3 | stamen development | GO:0048443 | Biological Process | 0.0 | - |
| Sma3 | lateral root development | GO:0048527 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Peptidase, cysteine peptidase active site | IPR000169 | - | 0.0 | - |
| Sma3 | ABC transporter, transmembrane domain | IPR001140 | - | 0.0 | - |
| Sma3 | F-box domain, cyclin-like | IPR001810 | - | 0.0 | - |
| Sma3 | Ribosomal protein L10, eubacterial, conserved site | IPR002363 | - | 0.0 | - |
| Sma3 | ABC transporter-like | IPR003439 | - | 0.0 | - |
| Sma3 | AAA+ ATPase domain | IPR003593 | - | 0.0 | - |
| Sma3 | K Homology domain, type 1 | IPR004088 | - | 0.0 | - |
| Sma3 | Vacuolar fusion protein MON1 | IPR004353 | - | 0.0 | - |
| Sma3 | Leucine-rich repeat 2 | IPR013101 | - | 0.0 | - |
| Sma3 | IPR013596 | - | 0.0 | - | |
| Sma3 | ABC transporter, conserved site | IPR017871 | - | 0.0 | - |
| Sma3 | ABC transporter, integral membrane type 1 | IPR017940 | - | 0.0 | - |
| Sma3 | Cytochrome P450, conserved site | IPR017972 | - | 0.0 | - |
| Sma3 | HTH domain AraC-type, conserved site | IPR018062 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G28010.1 | PGP14, ATABCB14, ABCB14 P-glycoprotein 14 chr1:9763436-9767917 FORWARD LENGTH=1247 | 3.0e-19 | 74% |
| RefSeq | Arabidopsis thaliana | NP_174122.1 | ABC transporter B family member 14 [Arabidopsis thaliana] | 3.0e-19 | 74% |
| RefSeq | Populus trichocarpa | XP_002309006.1 | multidrug/pheromone exporter, MDR family, ABC transporter family [Populus trichocarpa] | 2.0e-22 | 80% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: E6Y0T0
Fln msg: Unexpected STOP codon at 3' end. Distance to subject end: 115 aas, your sequence is shorter than subject: 56 - 1316
Fln protein:
S
Protein Length:
57
Fln nts:
G
Fln Alignment:
GD4IA4403G02IK___FNLRCLRKHIALVPQEPTLFAGSIRENIAYGKENATEAEIVEAAKTANAHEFIS
E6Y0T0_______________FQLKWIRQKIGLVSQEPVLFGTTIKENLLYGKDGATLEEIKAAAELANAAKFIN

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta