SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene77453

Length: 495 nt

UniGene Fasta

>sp_v3.0_unigene77453
AGCGCATCTATGAACTTATTGTAATGATCGACCCCTGCTTGGTTCATATATGCGCTCTTGGAAAACGGAATCGAGCCATACGTGACTCTGTATCACTGGGACCTTCCACAAGCGCTAGAGGATGCCTATAAGGGATGGCTAAACTCTAAAATTATAGAGGACTATGGGAAGTTCGCAGAAACATGCTTCGAGAAATTTGGGGACAGAGTGAAGAACTGGATGACATTCAATGAGCCTCACACGTTTGCCGTACAGGGCTACGATACAGGCTTCTATCCTCCCGGGCGATGCTCCATTCTGTTCCACCTCTTTTGCCGCTTTGGGAATTCCGCTACGGAGCCCTATATTGTTGCTCATAACGTGCTTCTTTCTCATGCCAAATCCGTGGACATATACAGGAAAACTATAAGGCAAAGCAAGGTGGAAGAATCGGTATCGCCTTGGATGTGATATGGTACGAGCCAATGTCCGATTCACCTGAAGATATTGTAGACC

Ace file of the UniGene sp_v3.0_unigene77453

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	Identity
AutoFact	Putative beta-glucosidase [Oryza sativa Japonica Group]	-	-	69%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	66%
Sma3	Beta-glucosidase, putative	-	-	-

Source	ECs	Term	Type	e value	Identity
Sma3	Prunasin beta-glucosidase.	EC:3.2.1.118	-	9.273e-11	-

Source	KEGGs	Term	Type	e value	Identity
Sma3	Cyanoamino acid metabolism	00460		9.273e-11	%
Sma3	Thioglucosidase.	EC:3.2.1.147	-	1.715e-06	-

Source	KEGGs	Term	Type	e value	Identity
Sma3	Tryptophan metabolism	00380		1.715e-06	%
Sma3	Beta-glucosidase.	EC:3.2.1.21	-	0.0	-

Source	KEGGs	Term	Identity
Sma3	Cyanoamino acid metabolism	00460	%
Sma3	Starch and sucrose metabolism	00500	%
Sma3	Phenylpropanoid biosynthesis	00940	%
Sma3	Biosynthesis of secondary metabolites	01110	%

Source	Gene names
Sma3	AH1; AT3G18080; AT4g21760; AT4g27820; AT4g27830; At1g02850; At1g02850/F22D16.15; At1g26560; At1g47600; At1g51470; At1g60270; At2g25630; At2g44450; At2g44460; At2g44470; At2g44480; At3g18080; At3g60140; At4g27830; At5g42260; At5g44640; BGL; BGLU1; BGQ60; F

Source	GOs	Term	Type	Identity
Sma3	cell wall	GO:0005618	Cellular Component	-
Sma3	intracellular	GO:0005622	Cellular Component	-
Sma3	vacuole	GO:0005773	Cellular Component	-
Sma3	peroxisome	GO:0005777	Cellular Component	-
Sma3	plant-type cell wall	GO:0009505	Cellular Component	-
Sma3	chloroplast	GO:0009507	Cellular Component	-
Sma3	membrane	GO:0016020	Cellular Component	-
Sma3	cytosolic ribosome	GO:0022626	Cellular Component	-
Sma3	apoplast	GO:0048046	Cellular Component	-
Sma3	DNA binding	GO:0003677	Molecular Function	-
Sma3	hydrolase activity, hydrolyzing O-glycosyl compounds	GO:0004553	Molecular Function	-
Sma3	beta-mannosidase activity	GO:0004567	Molecular Function	-
Sma3	sugar binding	GO:0005529	Molecular Function	-
Sma3	zinc ion binding	GO:0008270	Molecular Function	-
Sma3	beta-glucosidase activity	GO:0008422	Molecular Function	-
Sma3	thioglucosidase activity	GO:0019137	Molecular Function	-
Sma3	pectinesterase activity	GO:0030599	Molecular Function	-
Sma3	beta-D-fucosidase activity	GO:0033907	Molecular Function	-
Sma3	cation binding	GO:0043169	Molecular Function	-
Sma3	protein dimerization activity	GO:0046983	Molecular Function	-
Sma3	amygdalin beta-glucosidase activity	GO:0047668	Molecular Function	-
Sma3	prunasin beta-glucosidase activity	GO:0050224	Molecular Function	-
Sma3	strictosidine beta-glucosidase activity	GO:0050422	Molecular Function	-
Sma3	beta-primeverosidase activity	GO:0050535	Molecular Function	-
Sma3	carbohydrate metabolic process	GO:0005975	Biological Process	-
Sma3	response to salt stress	GO:0009651	Biological Process	-
Sma3	cytokinin mediated signaling pathway	GO:0009736	Biological Process	-
Sma3	cell wall modification	GO:0042545	Biological Process	-
Sma3	response to other organism	GO:0051707	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	Pectinesterase, catalytic	IPR000070	-	-
Sma3	Legume lectin domain	IPR001220	-	-
Sma3	Glycoside hydrolase, family 1	IPR001360	-	-
Sma3	Zinc finger, BED-type predicted	IPR003656	-	-
Sma3	Domain of unknown function DUF659	IPR007021	-	-
Sma3	Zinc finger, C2H2	IPR007087	-	-
Sma3	HAT dimerisation	IPR008906	-	-
Sma3		IPR011523	-	-
Sma3	Glycoside hydrolase, subgroup, catalytic domain	IPR013781	-	-
Sma3	Zinc finger, C2H2-like	IPR015880	-	-
Sma3	Glycoside hydrolase, family 1, beta-glucosidase	IPR017736	-	-
Sma3	DNA methylase, C-5 cytosine-specific, active site	IPR018117	-	-
Sma3	Glycoside hydrolase, family 1, active site	IPR018120	-	-

Source	Species	ID	Description	Identity
ATG	Arabidoptis thaliana	AT1G26560.1	BGLU40 beta glucosidase 40 chr1:9178513-9181726 FORWARD LENGTH=510	71%
RefSeq	Arabidopsis thaliana	NP_173978.1	beta glucosidase 40 [Arabidopsis thaliana]	71%
RefSeq	Populus trichocarpa	XP_002311330.1	predicted protein [Populus trichocarpa]	73%

Full-Lengther Next Prediction

Fln status: C-terminus

Fln database: coniferopsida.fasta

Fln subject: A9NZQ3

Fln msg: Unexpected stop codon in the beginning of your sequence,

Fln protein: SASMNLL**STPAWFIYALLENGIEPYVTLYHWDLPQALEDAYKGWLNSKIIEDYGKFAETCFEKFGDRVKNWMTFNEPHTFAVQGYDTGFYPPGRCSILFHLFCRFGNSATEPYIVAHNVLLSHAKSVDIYRKTIRQSKVEESVSPWM*

Protein Length: 151

Fln nts: AGCGCATCTATGAACTTATTGTAATGATCGACCCCTGCTTGGTTCATATATGCGCTCTTGGAAAACGGAATCGAGCCATACGTGACTCTGTATCACTGGGACCTTCCACAAGCGCTAGAGGATGCCTATAAGGGATGGCTAAACTCTAAAATTATAGAGGACTATGGGAAGTTCGCAGAAACATGCTTCGAGAAATTTGGGGACAGAGTGAAGAACTGGATGACATTCAATGAGCCTCACACGTTTGCCGTACAGGGCTACGATACAGGCTTCTATCCTCCCGGGCGATGCTCCATTCTGTTCCACCTCTTTTGCCGCTTTGGGAATTCCGCTACGGAGCCCTATATTGTTGCTCATAACGTGCTTCTTTCTCATGCCAAATCCGTGGACATATACAGGAAAACTATAAGGCAAAGCAAGGTGGAAGAATCGGTATCGCCTTGGATGTGA___TATGGTACGAGCCAATGTCCGATTCACCTGAAGATATTGTAGACC

Fln Alignment:

GD4IA4403G1QM6___LLENGIEPYVTLYHWDLPQALEDAYKGWLNSKIIEDYGKFAETCFEKFGDRVKNWMTFNEPHTFAVQGYDTGFYPPGRCSILFHLFCRFGNSATEPYIVAHNVLLSHAKSVDIYRK
A9NZQ3_______________LLKRGITPYANLYHYDLPQGLETAYGGLLNSKVVDDYAKFAEFCFKTFGDRVKYWMTFNEPRVVAALGYDNGIFAPGRCSAPFG-NCTAGNSATEPYIVAHNLLLSHATAVKIYRE

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain