SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene77449

Length: 280 nt

UniGene Fasta

>sp_v3.0_unigene77449
TCTGTGGCCTTATATCAAATTATCTGTCGCATCTGGTGTGATGCTATGTTTAGAAACTTGGTATTACAGAGTATTGATCCTCTTGACAGGGCATCTAGCAGATGCGGAAGTAGCAGTTGATTCCCTTTCAATCTGCATCAACGTCAACAGTTGGGAAATGATGATACCAGTTGGATTTTTAGCGGCAATAGGAGTGAGGGTTGCCAATGAGCTAGGCGCTGGAAATGGAAAAGGAGCTAAATTTGCAGTGATTGTTTGTGCAAGTACTTCGAGTGCTATA

Ace file of the UniGene sp_v3.0_unigene77449

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	mate efflux domain-containing protein [Arabidopsis thaliana] gb\|AAK53040.1\|AF375456_1 AT5g65380/MNA5_11 [Arabidopsis thaliana] dbj\|BAB11560.1\| unnamed protein product [Arabidopsis thaliana] gb\|AAN28899.1\| At5g65380/MNA5_11 [Arabidopsis thaliana] gb\|AED980	-	-	6.0e-31	66%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	80%
Sma3	Multidrug resistance pump, putative	-	-	0.0	-

Source	Gene names
Sma3	117M18_23; AT1G61890; AT4g25640; At1g11670; At1g12950; At1g33080; At1g33090; At1g33100; At1g33110; At1g47530; At1g61890; At3g21690; At4g00350; At4g25640; At5g10420; At5g38030; At5g44050; At5g65380; DDTFR18; F12B17_230; F16N3.20; F8K4.9; F9L11.22; F9L11.23

Source	GOs	Term	Type	Identity
Sma3	plasma membrane	GO:0005886	Cellular Component	-
Sma3	membrane	GO:0016020	Cellular Component	-
Sma3	DNA binding	GO:0003677	Molecular Function	-
Sma3	RNA binding	GO:0003723	Molecular Function	-
Sma3	RNA-directed DNA polymerase activity	GO:0003964	Molecular Function	-
Sma3	aspartic-type endopeptidase activity	GO:0004190	Molecular Function	-
Sma3	drug transmembrane transporter activity	GO:0015238	Molecular Function	-
Sma3	antiporter activity	GO:0015297	Molecular Function	-
Sma3	carbon-sulfur lyase activity	GO:0016846	Molecular Function	-
Sma3	RNA-dependent DNA replication	GO:0006278	Biological Process	-
Sma3	proteolysis	GO:0006508	Biological Process	-
Sma3	drug transmembrane transport	GO:0006855	Biological Process	-
Sma3	response to nematode	GO:0009624	Biological Process	-
Sma3	DNA integration	GO:0015074	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	Ribosome-binding factor A	IPR000238	-	-
Sma3	GPCR, rhodopsin-like, 7TM	IPR000276	-	-
Sma3	Reverse transcriptase	IPR000477	-	-
Sma3	Integrase, catalytic core	IPR001584	-	-
Sma3	Peptidase M1, alanine aminopeptidase/leukotriene A4 hydrolase	IPR001930	-	-
Sma3	Multi antimicrobial extrusion protein	IPR002528	-	-
Sma3	Allinase, C-terminal	IPR006948	-	-
Sma3	Peptidase M1, alanyl aminopeptidase	IPR012779	-	-
Sma3	Reverse transcriptase, RNA-dependent DNA polymerase	IPR013103	-	-
Sma3	Peptidase M1, membrane alanine aminopeptidase, N-terminal	IPR014782	-	-
Sma3	Aldehyde dehydrogenase, conserved site	IPR016160	-	-
Sma3	Protein kinase, ATP binding site	IPR017441	-	-
Sma3	Proteinase inhibitor I25, cystatin, conserved site	IPR018073	-	-
Sma3	Ribosomal protein S2, conserved site	IPR018130	-	-
Sma3	Chaperonin Cpn60, conserved site	IPR018370	-	-
Sma3	DNA-directed DNA polymerase, family A, conserved site	IPR019760	-	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	AT5G65380.1	MATE efflux family protein chr5:26123241-26126352 REVERSE LENGTH=486	8.0e-39	66%
RefSeq	Arabidopsis thaliana	NP_201341.1	mate efflux domain-containing protein [Arabidopsis thaliana]	1.0e-38	66%
RefSeq	Populus trichocarpa	XP_002310871.1	predicted protein [Populus trichocarpa]	8.99998e-41	70%

Full-Lengther Next Prediction

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: A9NVJ0

Fln msg: Distance to subject end: 148 aas, your sequence is shorter than subject: 93 - 503

Fln protein: LWPYIKLSVASGVMLCLETWYYRVLILLTGHLADAEVAVDSLSICINVNSWEMMIPVGFLAAIGVRVANELGAGNGKGAKFAVIVCASTSSAI

Protein Length: 94

Fln nts: TCTGTGGCCTTATATCAAATTATCTGTCGCATCTGGTGTGATGCTATGTTTAGAAACTTGGTATTACAGAGTATTGATCCTCTTGACAGGGCATCTAGCAGATGCGGAAGTAGCAGTTGATTCCCTTTCAATCTGCATCAACGTCAACAGTTGGGAAATGATGATACCAGTTGGATTTTTAGCGGCAATAGGAGTGAGGGTTGCCAATGAGCTAGGCGCTGGAAATGGAAAAGGAGCTAAATTTGCAGTGATTGTTTGTGCAAGTACTTCGAGTGCTATA

Fln Alignment:

GD4IA4403G5MD7___LWPYIKLSVASGVMLCLETWYYRVLILLTGHLADAEVAVDSLSICINVNSWEMMIPVGFLAAIGVRVANELGAGNGKGAKFAVIVCASTSSAI
A9NVJ0_______________LWPFIKLSIASGVMLCLEIWYYRVLILLTGHLADAETALDSLSICMNINGLEVMIPLAFLAATGVRVANELGSGNGKGAKFAVIVSVTTSCAI

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain