UniGene Name: sp_v3.0_unigene77362
Length: 247 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene77362
T |
Ace file of the UniGene sp_v3.0_unigene77362 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Glyceraldehyde-3-phosphate dehydrogenase n=5 Tax=Pinaceae RepID=Q37264_PINSY | - | - | 2.0e-29 | 94% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 88% |
| Sma3 | NAD-dependent glyceraldehyde-3-phosphate dehydrogenase | - | - | 9.17701e-40 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Glyceraldehyde-3-phosphate dehydrogenase (phosphorylating). | EC:1.2.1.12 | - | 2.66247e-44 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Glycolysis / Gluconeogenesis | 00010 | 2.66247e-44 | % | |
| Sma3 | Biosynthesis of phenylpropanoids | 01061 | 2.66247e-44 | % | |
| Sma3 | Biosynthesis of terpenoids and steroids | 01062 | 2.66247e-44 | % | |
| Sma3 | Biosynthesis of alkaloids derived from shikimate pathway | 01063 | 2.66247e-44 | % | |
| Sma3 | Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid | 01064 | 2.66247e-44 | % | |
| Sma3 | Biosynthesis of alkaloids derived from histidine and purine | 01065 | 2.66247e-44 | % | |
| Sma3 | Biosynthesis of alkaloids derived from terpenoid and polyketide | 01066 | 2.66247e-44 | % | |
| Sma3 | Biosynthesis of plant hormones | 01070 | 2.66247e-44 | % | |
| Sma3 | Metabolic pathways | 01100 | 2.66247e-44 | % | |
| Sma3 | Biosynthesis of secondary metabolites | 01110 | 2.66247e-44 | % |
| Source | Gene names |
|---|---|
| Sma3 | At1g16300; At1g79530; At1g79530/T8K14_5; F3O9.10; G3PDH; GAPC; GAPDH; GAPDH1; GSVIVT00002074001; GSVIVT00020570001; GSVIVT00035097001; GapC; GapC-III; GapCp; GapCp1; OJ1116_A06.36; Os02g0171100; Os06g0666600; OsI_06028; OsI_24036; OsJ_05558; OsJ_22288; P0 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | glyceraldehyde-3-phosphate dehydrogenase (NAD+) (phosphorylating) activity | GO:0004365 | Molecular Function | 0.0 | - |
| Sma3 | triose-phosphate isomerase activity | GO:0004807 | Molecular Function | 0.0 | - |
| Sma3 | NAD binding | GO:0051287 | Molecular Function | 0.0 | - |
| Sma3 | glucose metabolic process | GO:0006006 | Biological Process | 0.0 | - |
| Sma3 | glycolysis | GO:0006096 | Biological Process | 0.0 | - |
| Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | IPR000173 | - | 0.0 | - | |
| Sma3 | Triosephosphate isomerase | IPR000652 | - | 0.0 | - |
| Sma3 | Glyceraldehyde-3-phosphate dehydrogenase, type I | IPR006424 | - | 0.0 | - |
| Sma3 | Aldolase-type TIM barrel | IPR013785 | - | 0.0 | - |
| Sma3 | NAD(P)-binding domain | IPR016040 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G79530.1 | GAPCP-1 glyceraldehyde-3-phosphate dehydrogenase of plastid 1 chr1:29916232-29919088 REVERSE LENGTH=422 | 1.0e-31 | 83% |
| RefSeq | Arabidopsis thaliana | NP_178071.1 | glyceraldehyde 3-phosphate dehydrogenase [Arabidopsis thaliana] | 2.0e-31 | 83% |
| RefSeq | Populus trichocarpa | XP_002312235.1 | predicted protein [Populus trichocarpa] | 4.0e-32 | 83% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NLJ7
Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 36 aas, your sequence is shorter than subject: 82 - 209
Fln protein:
Q
Protein Length:
83
Fln nts:
T
Fln Alignment:
GD4IA4403F0Z21___QLPTPNVSVVDLTCRLAKPASYDDIKAAMKAASEGSLKGILGYTDEDVVSNDFVGDSRSSIFDAKAGIA
A9NLJ7_______________RVPTPNVSVVDLTCRLVKPASYDDVKAAIKAASEGSLKGILGYTDEDVVSNDFIGDERSSIFDSKAGIA

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta (sense)