UniGene Name: sp_v3.0_unigene77316
Length: 237 nt
![]() |
---|
>sp_v3.0_unigene77316
A |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | putative transcription factor [Arabidopsis thaliana] | - | - | 3.0e-16 | 76% |
FL-Next | tr=R2R3-MYB transcription factor MYB5; Picea glauca (White spruce) (Pinus glauca). | - | - | 0.0 | 52% |
Sma3 | MYB transcription factor | - | - | 3.754e-16 | - |
Source | Gene names |
---|---|
Sma3 | 117M18_17; 23.t00069; 80A08_26; At1g34670; At1g35515; At1g66230; At3g01140; At3g13540; At4g05100; At4g17785; At4g34990; At4g38620; At5g10280; At5g15310; At5g16600; At5g65230; DcMYB2; F18D22_50; F20M13.180; F21H2.9; F8M21_200; FCA0; GSVIVT00003904001; GSVI |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | cysteine-type peptidase activity | GO:0008234 | Molecular Function | 0.0 | - |
Sma3 | cell morphogenesis | GO:0000902 | Biological Process | 0.0 | - |
Sma3 | regulation of transcription, DNA-dependent | GO:0006355 | Biological Process | 0.0 | - |
Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
Sma3 | cold acclimation | GO:0009631 | Biological Process | 0.0 | - |
Sma3 | response to salt stress | GO:0009651 | Biological Process | 0.0 | - |
Sma3 | response to ethylene stimulus | GO:0009723 | Biological Process | 0.0 | - |
Sma3 | response to auxin stimulus | GO:0009733 | Biological Process | 0.0 | - |
Sma3 | response to abscisic acid stimulus | GO:0009737 | Biological Process | 0.0 | - |
Sma3 | response to gibberellin stimulus | GO:0009739 | Biological Process | 0.0 | - |
Sma3 | response to salicylic acid stimulus | GO:0009751 | Biological Process | 0.0 | - |
Sma3 | response to jasmonic acid stimulus | GO:0009753 | Biological Process | 0.0 | - |
Sma3 | trichome morphogenesis | GO:0010090 | Biological Process | 0.0 | - |
Sma3 | response to UV-B | GO:0010224 | Biological Process | 0.0 | - |
Sma3 | GO:0016481 | Biological Process | 0.0 | - | |
Sma3 | GO:0045449 | Biological Process | 0.0 | - | |
Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
Sma3 | mucilage biosynthetic process involved in seed coat development | GO:0048354 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | SANT/Myb domain | IPR001005 | - | 0.0 | - |
Sma3 | Peptidase C48, SUMO/Sentrin/Ubl1 | IPR003653 | - | 0.0 | - |
Sma3 | Transposon, En/Spm-like | IPR004242 | - | 0.0 | - |
Sma3 | IPR012287 | - | 0.0 | - | |
Sma3 | IPR014778 | - | 0.0 | - | |
Sma3 | Myb transcription factor | IPR015495 | - | 0.0 | - |
Sma3 | Myb-like domain | IPR017877 | - | 0.0 | - |
Sma3 | Myb domain, DNA-binding | IPR017930 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G65230.1 | AtMYB53, MYB53 myb domain protein 53 chr5:26068290-26069408 FORWARD LENGTH=310 | 6.0e-22 | 76% |
RefSeq | Arabidopsis thaliana | NP_201326.1 | myb domain protein 53 [Arabidopsis thaliana] | 8.0e-22 | 76% |
RefSeq | Populus trichocarpa | XP_002325546.1 | predicted protein [Populus trichocarpa] | 2.0e-22 | 52% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A5JYE9
Fln msg: Distance to subject end: 89 aas, your sequence is shorter than subject: 79 - 257
Fln protein:
N
Protein Length:
80
Fln nts:
A
Fln Alignment:
GD4IA4403GPZDW___NRWSMIASKLPGRTDNEIKNYWNTHLKKKLRNMGLDPQTHQPR---HDASTSSTSIPKFTIQTASTSSNYIPEM
A5JYE9_______________NKWSLIAGRLPGRTDNEIKNYWNTHIKRKLLNKGLDPQSHRPLGQVHSSNTTCSSLPAPEHEILAFQSPRTPEI
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain