UniGene Name: sp_v3.0_unigene77287
Length: 216 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene77287
A |
Ace file of the UniGene sp_v3.0_unigene77287
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | ATP synthase subunit beta n=2 Tax=Agaricales RepID=B0CSN1_LACBS | - | - | 4.0e-32 | 95% |
| FL-Next | sp=ATP synthase subunit beta; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 72% |
| Sma3 | ATP synthase subunit beta | - | - | 1.734e-20 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | H(+)-transporting two-sector ATPase. | EC:3.6.3.14 | - | 3.179e-24 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Oxidative phosphorylation | 00190 | 3.179e-24 | % | |
| Sma3 | Photosynthesis | 00195 | 3.179e-24 | % | |
| Sma3 | Methane metabolism | 00680 | 3.179e-24 | % | |
| Sma3 | Metabolic pathways | 01100 | 3.179e-24 | % |
| Source | Gene names |
|---|---|
| Sma3 | ATP2; ATPB; At5g08670; At5g08670/T2K12_20; At5g08680; At5g08690; At5g08690/T2K12_40; AtpB; CHLREDRAFT_78348; F1 ATPase; GSVIVT00017772001; GSVIVT00030440001; MICPUCDRAFT_49420; MICPUN_107337; OSTLU_119590; Os01g0685800; Os05g0553000; OsI_03305; OsI_20905; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | mitochondrial proton-transporting ATP synthase complex, catalytic core F(1) | GO:0000275 | Cellular Component | 0.0 | - |
| Sma3 | mitochondrial inner membrane | GO:0005743 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | thylakoid | GO:0009579 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast envelope | GO:0009941 | Cellular Component | 0.0 | - |
| Sma3 | plastid membrane | GO:0042170 | Cellular Component | 0.0 | - |
| Sma3 | proton-transporting ATP synthase complex, catalytic core F(1) | GO:0045261 | Cellular Component | 0.0 | - |
| Sma3 | plastid thylakoid membrane | GO:0055035 | Cellular Component | 0.0 | - |
| Sma3 | nucleotide binding | GO:0000166 | Molecular Function | 0.0 | - |
| Sma3 | copper ion binding | GO:0005507 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | hydrogen-exporting ATPase activity, phosphorylative mechanism | GO:0008553 | Molecular Function | 0.0 | - |
| Sma3 | hydrogen ion transporting ATP synthase activity, rotational mechanism | GO:0046933 | Molecular Function | 0.0 | - |
| Sma3 | proton-transporting ATPase activity, rotational mechanism | GO:0046961 | Molecular Function | 0.0 | - |
| Sma3 | ATP synthesis coupled proton transport | GO:0015986 | Biological Process | 0.0 | - |
| Sma3 | plasma membrane ATP synthesis coupled proton transport | GO:0042777 | Biological Process | 0.0 | - |
| Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | ATPase, F1/V1/A1 complex, alpha/beta subunit, nucleotide-binding domain | IPR000194 | - | 0.0 | - |
| Sma3 | ATPase, F1/V1/A1 complex, alpha/beta subunit, C-terminal | IPR000793 | - | 0.0 | - |
| Sma3 | AAA+ ATPase domain | IPR003593 | - | 0.0 | - |
| Sma3 | ATPase, F1/V1/A1 complex, alpha/beta subunit, N-terminal | IPR004100 | - | 0.0 | - |
| Sma3 | ATPase, F1 complex, beta subunit | IPR005722 | - | 0.0 | - |
| Sma3 | TonB box, conserved site | IPR010916 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT5G08690.1 | ATP synthase alpha/beta family protein chr5:2825739-2828352 FORWARD LENGTH=556 | 1.0e-26 | 72% |
| RefSeq | Arabidopsis thaliana | NP_568204.1 | ATP synthase subunit beta-2 [Arabidopsis thaliana] | 2.0e-26 | 72% |
| RefSeq | Populus trichocarpa | XP_002315902.1 | mitochondrial beta subunit of F1 ATP synthase [Populus trichocarpa] | 3.0e-27 | 72% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NUR7
Fln msg: Distance to subject end: 310 aas, your sequence is shorter than subject: 72 - 568
Fln protein:
I
Protein Length:
73
Fln nts:
A
Fln Alignment:
GD4IA4403HJUGB___IDERGPIQGVKLSPIHADPPPFVEQSTTAEVLETGIKVVDLLAPYARGGKIGLFGGAGVGKTVLIQELINNV
A9NUR7_______________IDHKGDLTTDHYLPIHREAPSFVEQSTEQEILVTGIKVVDLLAPYQRGGKIGLFGGAGVGKTVLIMELINNV

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta