UniGene Name: sp_v3.0_unigene77235
Length: 221 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene77235
A |
Ace file of the UniGene sp_v3.0_unigene77235
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Peptidyl-prolyl cis-trans isomerase n=1 Tax=Chlorella variabilis RepID=E1Z6E6_9CHLO | - | - | 4.0e-21 | 90% |
| FL-Next | sp=Peptidyl-prolyl cis-trans isomerase; Pinus halepensis (Aleppo pine). | - | - | 0.0 | 66% |
| Sma3 | Peptidyl-prolyl cis-trans isomerase | - | - | 0.0 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Peptidylprolyl isomerase. | EC:5.2.1.8 | - | 0.0 | - |
| Source | Gene names |
|---|---|
| Sma3 | 43H1; 46C02.10; 56B23-g9; AT3G63400; At2g16600; At2g21130; At2g29960; At3g55920; At3g63400; At4g34870; At4g38740; CHLREDRAFT_136386; CHLREDRAFT_196289; CHLREDRAFT_34270; CHLREDRAFT_56399; CYC063; CYN19-1; CYN19-2; CYN20-1; CYN40; CYP; CYP1; CYP18; CYP18-2 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | membrane fraction | GO:0005624 | Cellular Component | 0.0 | - |
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | multivesicular body | GO:0005771 | Cellular Component | 0.0 | - |
| Sma3 | endoplasmic reticulum | GO:0005783 | Cellular Component | 0.0 | - |
| Sma3 | Golgi stack | GO:0005795 | Cellular Component | 0.0 | - |
| Sma3 | cytosol | GO:0005829 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
| Sma3 | peptidyl-prolyl cis-trans isomerase activity | GO:0003755 | Molecular Function | 0.0 | - |
| Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
| Sma3 | peptide binding | GO:0042277 | Molecular Function | 0.0 | - |
| Sma3 | protein folding | GO:0006457 | Biological Process | 0.0 | - |
| Sma3 | RNA splicing | GO:0008380 | Biological Process | 0.0 | - |
| Sma3 | plant-type hypersensitive response | GO:0009626 | Biological Process | 0.0 | - |
| Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Peptidyl-prolyl cis-trans isomerase, FKBP-type, domain | IPR001179 | - | 0.0 | - |
| Sma3 | Tetratricopeptide TPR-1 | IPR001440 | - | 0.0 | - |
| Sma3 | Cyclophilin-like peptidyl-prolyl cis-trans isomerase domain | IPR002130 | - | 0.0 | - |
| Sma3 | Tetratricopeptide-like helical | IPR011990 | - | 0.0 | - |
| Sma3 | Tetratricopeptide repeat-containing domain | IPR013026 | - | 0.0 | - |
| Sma3 | Tetratricopeptide TPR2 | IPR013105 | - | 0.0 | - |
| Sma3 | Tetratricopeptide repeat | IPR019734 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT2G21130.1 | Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein chr2:9055619-9056143 REVERSE LENGTH=174 | 1.0e-19 | 93% |
| RefSeq | Arabidopsis thaliana | NP_179709.1 | Peptidyl-prolyl cis-trans isomerase CYP19-2 [Arabidopsis thaliana] | 1.0e-19 | 93% |
| RefSeq | Populus trichocarpa | XP_002305488.1 | predicted protein [Populus trichocarpa] | 7.0e-22 | 83% |
Full-Lengther Next Prediction |
|---|
Fln status: N-terminus
Fln database: coniferopsida.fasta
Fln subject: Q5Y2E8
Fln msg: Overlapping hits, possible frame ERROR between 130 and 129, Distance to subject end: 106 aas, your sequence is shorter than subject: 67 - 172
Fln protein:
M
Protein Length:
68
Fln nts:
A
Fln Alignment:
GD4IA4402DIH2K___MSKSQVFFDVTAGGQPLGRIVMELRGDVVPNTAENxRALCTGEKGTGRSGKPLHFKGASFHRVIP
Q5Y2E8_______________MPNPKVFFDMQVGGAPAGRIVMELYADVVPKTAENxRALCTGEKGTGRSGKPLHFKGSSFHRVIP

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta