UniGene Name: sp_v3.0_unigene77234
Length: 167 nt
UniGene Fasta |
---|
>sp_v3.0_unigene77234
C |
Ace file of the UniGene sp_v3.0_unigene77234 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Probable glutathione-dependent formaldehyde dehydrogenase n=1 Tax=Sporisorium reilianum RepID=E6ZWB0_9BASI | - | - | 3.0e-23 | 90% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 77% |
Sma3 | Glutathione-dependent formaldehyde dehydrogenase | - | - | 1.625e-20 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Oxidoreductases, Acting on the CH-OH group of donors, With NAD(+) or NADP(+) as acceptor. | EC:1.1.1.- | - | 3.313e-12 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Glycolysis / Gluconeogenesis | 00010 | 9.114e-08 | % | |
Sma3 | Fatty acid metabolism | 00071 | 9.114e-08 | % | |
Sma3 | Glycine, serine and threonine metabolism | 00260 | 9.114e-08 | % | |
Sma3 | Tyrosine metabolism | 00350 | 9.114e-08 | % | |
Sma3 | Chloroalkane and chloroalkene degradation | 00625 | 9.114e-08 | % | |
Sma3 | Naphthalene degradation | 00626 | 9.114e-08 | % | |
Sma3 | Retinol metabolism | 00830 | 9.114e-08 | % | |
Sma3 | Metabolism of xenobiotics by cytochrome P450 | 00980 | 9.114e-08 | % | |
Sma3 | Drug metabolism - cytochrome P450 | 00982 | 9.114e-08 | % | |
Sma3 | Metabolic pathways | 01100 | 9.114e-08 | % | |
Sma3 | Biosynthesis of secondary metabolites | 01110 | 9.114e-08 | % | |
Sma3 | S-(hydroxymethyl)glutathione dehydrogenase. | EC:1.1.1.284 | - | 4.059e-16 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Methane metabolism | 00680 | 4.059e-16 | % |
Source | Gene names |
---|---|
Sma3 | ADH2; ADHIII; ADHX; At5g43940; CHLREDRAFT_129874; CT208; FDH; FDH1; GSH-FDH1; GSH-FDH2; GSVIVT00028477001; LOC_Os02g57040; MICPUCDRAFT_56831; MICPUCDRAFT_58498; MICPUN_56654; MRH10.4; OSTLU_27414; Os02g0815500; OsI_009236; OsJ_008550; Ot15g01360; P0643F09 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
Sma3 | peroxisome | GO:0005777 | Cellular Component | 0.0 | - |
Sma3 | alcohol dehydrogenase (NAD) activity | GO:0004022 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | oxidoreductase activity | GO:0016491 | Molecular Function | 0.0 | - |
Sma3 | S-(hydroxymethyl)glutathione dehydrogenase activity | GO:0051903 | Molecular Function | 0.0 | - |
Sma3 | S-nitrosoglutathione reductase activity | GO:0080007 | Molecular Function | 0.0 | - |
Sma3 | ethanol oxidation | GO:0006069 | Biological Process | 0.0 | - |
Sma3 | heat acclimation | GO:0010286 | Biological Process | 0.0 | - |
Sma3 | formaldehyde metabolic process | GO:0046292 | Biological Process | 0.0 | - |
Sma3 | seed development | GO:0048316 | Biological Process | 0.0 | - |
Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Putative esterase | IPR000801 | - | 0.0 | - |
Sma3 | Legume lectin domain | IPR001220 | - | 0.0 | - |
Sma3 | Alcohol dehydrogenase superfamily, zinc-type | IPR002085 | - | 0.0 | - |
Sma3 | Alcohol dehydrogenase, zinc-type, conserved site | IPR002328 | - | 0.0 | - |
Sma3 | Alcohol dehydrogenase, C-terminal | IPR013149 | - | 0.0 | - |
Sma3 | Alcohol dehydrogenase GroES-like | IPR013154 | - | 0.0 | - |
Sma3 | Alcohol dehydrogenase class III/S-(hydroxymethyl)glutathione dehydrogenase | IPR014183 | - | 0.0 | - |
Sma3 | S-formylglutathione hydrolase | IPR014186 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G43940.2 | HOT5 GroES-like zinc-binding dehydrogenase family protein chr5:17684265-17686379 FORWARD LENGTH=391 | 5.0e-26 | 79% |
RefSeq | Arabidopsis thaliana | NP_199207.1 | alcohol dehydrogenase class-3 [Arabidopsis thaliana] | 6.0e-26 | 79% |
RefSeq | Populus trichocarpa | XP_002321299.1 | glutathione-dependent formaldehyde dehydrogenase [Populus trichocarpa] | 6.0e-26 | 79% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NRF6
Fln msg: Distance to subject end: 59 aas, your sequence is shorter than subject: 55 - 384
Fln protein:
C
Protein Length:
56
Fln nts:
C
Fln Alignment:
GD4IA4402C69IT___CTGNVQVMRSALEACHKGWGVSTIIGVAAAGKEISTRPFQLVTGRKWQGTAFGG
A9NRF6_______________CVGNVSLMRAALECCHKGWGTSVIVGVAASGQEISTRPFQLVTGRVWKGTAFGG
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain