|
||||||
|
UniGene Name: sp_v3.0_unigene77208
Length: 228 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene77208
G |
|
Ace file of the UniGene sp_v3.0_unigene77208
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Catalase n=3 Tax=Picea sitchensis RepID=A9NUY8_PICSI | - | - | 2.0e-11 | 76% |
| FL-Next | sp=Catalase-3; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 62% |
| Sma3 | Catalase | - | - | 1.252e-18 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Catalase. | EC:1.11.1.6 | - | 7.509e-13 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Tryptophan metabolism | 00380 | 7.509e-13 | % | |
| Sma3 | Methane metabolism | 00680 | 7.509e-13 | % | |
| Sma3 | Metabolic pathways | 01100 | 7.509e-13 | % |
| Source | Gene names |
|---|---|
| Sma3 | AT1G20620; At1g20620; CAT3; F2D10.40; F5M15.5; LSC650; PHYPADRAFT_64727; cat1; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | cell wall | GO:0005618 | Cellular Component | 0.0 | - |
| Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
| Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
| Sma3 | peroxisome | GO:0005777 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast stroma | GO:0009570 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast envelope | GO:0009941 | Cellular Component | 0.0 | - |
| Sma3 | cytosolic ribosome | GO:0022626 | Cellular Component | 0.0 | - |
| Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
| Sma3 | catalase activity | GO:0004096 | Molecular Function | 0.0 | - |
| Sma3 | iron ion binding | GO:0005506 | Molecular Function | 0.0 | - |
| Sma3 | heme binding | GO:0020037 | Molecular Function | 0.0 | - |
| Sma3 | response to oxidative stress | GO:0006979 | Biological Process | 0.0 | - |
| Sma3 | cellular response to nitrogen starvation | GO:0006995 | Biological Process | 0.0 | - |
| Sma3 | response to cold | GO:0009409 | Biological Process | 0.0 | - |
| Sma3 | response to light stimulus | GO:0009416 | Biological Process | 0.0 | - |
| Sma3 | cellular response to sulfate starvation | GO:0009970 | Biological Process | 0.0 | - |
| Sma3 | cellular response to phosphate starvation | GO:0016036 | Biological Process | 0.0 | - |
| Sma3 | hydrogen peroxide catabolic process | GO:0042744 | Biological Process | 0.0 | - |
| Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
| Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Catalase haem-binding site | IPR002226 | - | 0.0 | - |
| Sma3 | Catalase immune-responsive domain | IPR010582 | - | 0.0 | - |
| Sma3 | Catalase core domain | IPR011614 | - | 0.0 | - |
| Sma3 | Beta tubulin, autoregulation binding site | IPR013838 | - | 0.0 | - |
| Sma3 | Catalase, mono-functional, haem-containing | IPR018028 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G20620.1 | CAT3, SEN2, ATCAT3 catalase 3 chr1:7143142-7146193 FORWARD LENGTH=492 | 1.0e-11 | 62% |
| RefSeq | Arabidopsis thaliana | NP_001031072.3 | catalase 3 [Arabidopsis thaliana] | 1.0e-11 | 62% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q42547
Fln msg: Distance to subject end: 216 aas, your sequence is shorter than subject: 76 - 492
Fln protein:
A
Protein Length:
77
Fln nts:
G
Fln Alignment:
GD4IA4402ENYAF___KLKCVLKFLLDEEAVIVGGSNHSHATKDLTDAIASGT-TQMEALIQTMNP
Q42547_______________KPTCGIKNLTDEEAKVVGGANHSHATKDLHDAIASGNYPEWKLFIQTMDP
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
