UniGene Name: sp_v3.0_unigene77193
Length: 153 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene77193
A |
Ace file of the UniGene sp_v3.0_unigene77193 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Unassigned protein | - | - | 0.0 | - |
| FL-Next | Isoform 2 of Transcriptional activator DEMETER OS=Arabidopsis thaliana GN=DME | - | - | 0.0 | 82% |
| Sma3 | Repressor of silencing 1 | - | - | 1.284e-08 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Hydrolases, Glycosylases, Hydrolyzing N-glycosyl compounds. | EC:3.2.2.- | - | 1.178e-09 | - |
| Source | Gene names |
|---|---|
| Sma3 | At2g36490; At4g34060; At5g04560/At5g04570/At5g04580; DME; DML1; DML3; DNG1501; DNG701; DNG902; F1O11.12; F28A23.180; GSVIVT00005275001; GSVIVT00021675001; GSVIVT00022090001; GSVIVT00034990001; NtROS1; NtROS2a; NtROS2b; NtROS3; Os01g0217900; Os02g0494700; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
| Sma3 | catalytic activity | GO:0003824 | Molecular Function | 0.0 | - |
| Sma3 | DNA-(apurinic or apyrimidinic site) lyase activity | GO:0003906 | Molecular Function | 0.0 | - |
| Sma3 | endonuclease activity | GO:0004519 | Molecular Function | 0.0 | - |
| Sma3 | iron ion binding | GO:0005506 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | DNA N-glycosylase activity | GO:0019104 | Molecular Function | 0.0 | - |
| Sma3 | 4 iron, 4 sulfur cluster binding | GO:0051539 | Molecular Function | 0.0 | - |
| Sma3 | DNA repair | GO:0006281 | Biological Process | 0.0 | - |
| Sma3 | base-excision repair | GO:0006284 | Biological Process | 0.0 | - |
| Sma3 | DNA methylation | GO:0006306 | Biological Process | 0.0 | - |
| Sma3 | regulation of gene expression by genetic imprinting | GO:0006349 | Biological Process | 0.0 | - |
| Sma3 | regulation of transcription, DNA-dependent | GO:0006355 | Biological Process | 0.0 | - |
| Sma3 | embryo development ending in seed dormancy | GO:0009793 | Biological Process | 0.0 | - |
| Sma3 | maintenance of DNA methylation | GO:0010216 | Biological Process | 0.0 | - |
| Sma3 | negative regulation of chromatin silencing | GO:0031936 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Regulator of chromosome condensation, RCC1 | IPR000408 | - | 0.0 | - |
| Sma3 | HhH-GPD domain | IPR003265 | - | 0.0 | - |
| Sma3 | Endonuclease III-like, iron-sulphur cluster loop motif | IPR003651 | - | 0.0 | - |
| Sma3 | Endonuclease III, iron-sulphur binding site | IPR004035 | - | 0.0 | - |
| Sma3 | AT hook, DNA-binding motif | IPR017956 | - | 0.0 | - |
| Sma3 | EF-Hand 1, calcium-binding site | IPR018247 | - | 0.0 | - |
| Sma3 | EF-HAND 2 | IPR018249 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT5G04560.2 | DME HhH-GPD base excision DNA repair family protein chr5:1309786-1318091 FORWARD LENGTH=1987 | 1.0e-24 | 82% |
| RefSeq | Arabidopsis thaliana | NP_196076.2 | transcriptional activator DEMETER [Arabidopsis thaliana] | 2.0e-24 | 82% |
| RefSeq | Populus trichocarpa | XP_002311968.1 | predicted protein, partial [Populus trichocarpa] | 1.0e-25 | 80% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q8LK56-2
Fln msg: Distance to subject end: 363 aas, your sequence is shorter than subject: 50 - 674
Fln protein:
W
Protein Length:
51
Fln nts:
A
Fln Alignment:
GD4IA4402EODMP___WVPIEPLPESVQIHLLEQYPVLDSIQRYLWPRLCTLDQRTLYELHYQLIT
Q8LK56-2_____________WVPLQPLPESLQLHLLELYPVLESIQKFLWPRLCKLDQRTLYELHYQLIT

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta (sense)