|
||||||
|
UniGene Name: sp_v3.0_unigene77173
Length: 209 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene77173
A |
|
Ace file of the UniGene sp_v3.0_unigene77173
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | receptor-like protein kinase HAIKU2 [Arabidopsis thaliana] sp|Q9LJM4.1|IKU2_ARATH RecName: Full=Receptor-like protein kinase HAIKU2; Flags: Precursor dbj|BAB02557.1| receptor-like protein kinase [Arabidopsis thaliana] gb|AEE76277.1| receptor-like protein | - | - | 1.0e-15 | 60% |
| FL-Next | tr=Clavata-like receptor; Picea glauca (White spruce) (Pinus glauca). | - | - | 0.0 | 44% |
| Source | Gene names |
|---|---|
| Sma3 | At1g09970; At1g09970/F21M12.36; At3g19700; F21M12.36; GSVIVT00015034001; GSVIVT00038540001; IKU2; LOC_Os12g43640; LRR-RLK; MMB12.19; Os12g0632800; OsI_39239; OsJ_35661; OsJ_36977; POPTRDRAFT_1087454; RCOM_1584490; VITISV_033329; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | aminopeptidase activity | GO:0004177 | Molecular Function | 0.0 | - |
| Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
| Sma3 | receptor activity | GO:0004872 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
| Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
| Sma3 | endosperm development | GO:0009960 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Alpha/beta hydrolase fold-1 | IPR000073 | - | 0.0 | - |
| Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
| Sma3 | Leucine-rich repeat | IPR001611 | - | 0.0 | - |
| Sma3 | Peptidase S33 | IPR002410 | - | 0.0 | - |
| Sma3 | Proline iminopeptidase | IPR005944 | - | 0.0 | - |
| Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
| Sma3 | Leucine-rich repeat-containing N-terminal, type 2 | IPR013210 | - | 0.0 | - |
| Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
| Sma3 | IPR017442 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT3G19700.1 | IKU2 Leucine-rich repeat protein kinase family protein chr3:6843662-6846791 FORWARD LENGTH=991 | 3.0e-20 | 60% |
| RefSeq | Arabidopsis thaliana | NP_188604.1 | receptor-like protein kinase HAIKU2 [Arabidopsis thaliana] | 4.0e-20 | 60% |
| RefSeq | Populus trichocarpa | XP_002313944.1 | predicted protein [Populus trichocarpa] | 2.0e-17 | 56% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: Q19AV8
Fln msg: Distance to subject end: 651 aas, your sequence is shorter than subject: 69 - 998
Fln protein:
I
Protein Length:
70
Fln nts:
A
Fln Alignment:
GD4IA4402EPNK2___IPSGFRNLASLRLFDASKNSLNGTLSELASLNNLQSLHLYTNNISGEIPNEFGEFQHLVDLSLYENNLT
Q19AV8_______________IPVAMGELKALKRFDASMNMLNGSIPAGLGSLNLESLNLYQNDLVGEIPPGLGSFASLTELKLFSNRLT
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
