UniGene Name: sp_v3.0_unigene77171
Length: 165 nt
![]() |
---|
>sp_v3.0_unigene77171
A |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Leucine-rich repeat family protein / protein kinase family protein n=1 Tax=Glycine max RepID=C6ZRY3_SOYBN | - | - | 3.0e-12 | 64% |
FL-Next | tr=Uncharacterized protein; Cryptomeria japonica (Japanese cedar) (Cupressus japonica). | - | - | 0.0 | 55% |
Sma3 | Leucine-rich repeat receptor-like protein kinase | - | - | 5.614e-07 | - |
Source | Gene names |
---|---|
Sma3 | AT1G51810; AT5G16900; AT5G49760; AT5G59670; At1g21270; At1g51810; At1g51830; At2g29000; At3g46350; At5g38990; At5g49760; At5g49760/K2I5_13; At5g59670; B1148D12.10; F16F4.5; F18L15.70; F19C24.1; F19C24.22; F2K13_50; GSVIVT00000553001; GSVIVT00005293001; GS |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | nucleic acid binding | GO:0003676 | Molecular Function | 0.0 | - |
Sma3 | peptidyl-prolyl cis-trans isomerase activity | GO:0003755 | Molecular Function | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | protein tyrosine kinase activity | GO:0004713 | Molecular Function | 0.0 | - |
Sma3 | receptor activity | GO:0004872 | Molecular Function | 0.0 | - |
Sma3 | calcium ion binding | GO:0005509 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | sugar binding | GO:0005529 | Molecular Function | 0.0 | - |
Sma3 | protein folding | GO:0006457 | Biological Process | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | oligosaccharide metabolic process | GO:0009311 | Biological Process | 0.0 | - |
Sma3 | response to salicylic acid stimulus | GO:0009751 | Biological Process | 0.0 | - |
Sma3 | unidimensional cell growth | GO:0009826 | Biological Process | 0.0 | - |
Sma3 | cellular water homeostasis | GO:0009992 | Biological Process | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G48740.1 | Leucine-rich repeat protein kinase family protein chr5:19765324-19769314 REVERSE LENGTH=895 | 8.0e-16 | 55% |
RefSeq | Arabidopsis thaliana | NP_199685.2 | putative LRR receptor-like serine/threonine-protein kinase [Arabidopsis thaliana] | 1.0e-15 | 55% |
RefSeq | Populus trichocarpa | XP_002301786.1 | predicted protein [Populus trichocarpa] | 5.0e-16 | 60% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: I4DUG4
Fln msg: Distance to subject end: 124 aas, your sequence is shorter than subject: 55 - 892
Fln protein:
T
Protein Length:
56
Fln nts:
A
Fln Alignment:
GD4IA4402E1VNA___LHEG-----IHRDIKTANILLDRNFNGKLADFGLSRMAIEGEASYVTTSVKGTLGYLDP
I4DUG4_______________LHQGCNPPIIHRDIKCTNILLDARMNAKVADFGLAKL-LDRSQTYVSTAVKGTIGYLDP
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain