UniGene Name: sp_v3.0_unigene77150
Length: 174 nt
![]() |
---|
>sp_v3.0_unigene77150
G |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Phosphoribulokinase (Fragment) n=1 Tax=Picea abies RepID=Q3ZDJ0_PICAB | - | - | 1.0e-14 | 79% |
FL-Next | sp=Phosphoribulokinase; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 79% |
Sma3 | Phosphoribulokinase | - | - | 1.089e-39 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Phosphoribulokinase. | EC:2.7.1.19 | - | 0.0 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Carbon fixation in photosynthetic organisms | 00710 | 0.0 | % | |
Sma3 | Metabolic pathways | 01100 | 0.0 | % |
Source | Gene names |
---|---|
Sma3 | At1g32060; CHLREDRAFT_195910; GSVIVT00014038001; MICPUCDRAFT_49540; MICPUN_104911; OSJNBa0006A01.23; OSJNba0093F12.5; OSTLU_45513; Os02g0698000; OsI_08574; OsI_17227; OsJ_08032; OsJ_16006; Ot04g02900; P0459B01.11; PHYPADRAFT_108642; PHYPADRAFT_232765; PHY |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | chloroplast thylakoid membrane | GO:0009535 | Cellular Component | 0.0 | - |
Sma3 | chloroplast stroma | GO:0009570 | Cellular Component | 0.0 | - |
Sma3 | chloroplast envelope | GO:0009941 | Cellular Component | 0.0 | - |
Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | phosphoribulokinase activity | GO:0008974 | Molecular Function | 0.0 | - |
Sma3 | kinase activity | GO:0016301 | Molecular Function | 0.0 | - |
Sma3 | transcription regulator activity | GO:0030528 | Molecular Function | 0.0 | - |
Sma3 | carbohydrate metabolic process | GO:0005975 | Biological Process | 0.0 | - |
Sma3 | GO:0006350 | Biological Process | 0.0 | - | |
Sma3 | response to cold | GO:0009409 | Biological Process | 0.0 | - |
Sma3 | reductive pentose-phosphate cycle | GO:0019253 | Biological Process | 0.0 | - |
Sma3 | defense response to bacterium | GO:0042742 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Phosphoribulokinase | IPR006082 | - | 0.0 | - |
Sma3 | Phosphoribulokinase/uridine kinase | IPR006083 | - | 0.0 | - |
Sma3 | IPR010990 | - | 0.0 | - | |
Sma3 | IPR014765 | - | 0.0 | - | |
Sma3 | Transcription factor IIS, N-terminal | IPR017923 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G32060.1 | PRK phosphoribulokinase chr1:11532668-11534406 FORWARD LENGTH=395 | 2.0e-19 | 75% |
RefSeq | Arabidopsis thaliana | NP_174486.1 | phosphoribulokinase [Arabidopsis thaliana] | 2.0e-19 | 75% |
RefSeq | Populus trichocarpa | XP_002303455.1 | predicted protein [Populus trichocarpa] | 3.0e-19 | 75% |
![]() |
---|
Fln status: Putative C-terminus
Fln database: coniferopsida.fasta
Fln subject: C0PS66
Fln msg: Unexpected stop codon in the beginning of your sequence, STOP codon was not found. Distance to subject end: 13 aas, your sequence is shorter than subject: 58 - 400
Fln protein:
V
Protein Length:
59
Fln nts:
G
Fln Alignment:
GD4IA4402EIH6L___YVESHLSNISTKFYGEVTQQMLKHADFPGSNNGLEQTSAIVAPWKIWDVYEQII
C0PS66_______________YVESHLSNISTKFYGEVTQQMLKHADFPGSNNGTGLFQTIVG-LKIRDVYEQLI
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain