|
||||||
|
UniGene Name: sp_v3.0_unigene77131
Length: 178 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene77131
G |
|
Ace file of the UniGene sp_v3.0_unigene77131
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | IAA-amino acid hydrolase ILR1, putative n=1 Tax=Ricinus communis RepID=B9S5P0_RICCO | - | - | 5.0e-15 | 81% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 89% |
| Sma3 | IAA-amino acid hydrolase ILR1, putative | - | - | 8.714e-12 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Hydrolases, Acting on carbon-nitrogen bonds, other than peptide bonds, In linear amides. | EC:3.5.1.- | - | 3.987e-13 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Lysine biosynthesis | 00300 | 3.987e-13 | % | |
| Sma3 | Fluorobenzoate degradation | 00364 | 3.987e-13 | % | |
| Sma3 | Glutathione metabolism | 00480 | 3.987e-13 | % | |
| Sma3 | Amino sugar and nucleotide sugar metabolism | 00520 | 3.987e-13 | % | |
| Sma3 | Lipopolysaccharide biosynthesis | 00540 | 3.987e-13 | % | |
| Sma3 | Sphingolipid metabolism | 00600 | 3.987e-13 | % | |
| Sma3 | Metabolic pathways | 01100 | 3.987e-13 | % | |
| Sma3 | Biosynthesis of secondary metabolites | 01110 | 3.987e-13 | % | |
| Sma3 | Hippurate hydrolase. | EC:3.5.1.32 | - | 1.743e-11 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Phenylalanine metabolism | 00360 | 1.743e-11 | % | |
| Sma3 | Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid | 01064 | 1.743e-11 | % |
| Source | Gene names |
|---|---|
| Sma3 | At1g44350; At5g54140; CHLREDRAFT_105119; GR1; GSVIVT00037152001; GSVIVT00037153001; IAR33; IAR36; ILL11; ILL3; ILL5; ILL6; Iar3; Ill3; LOC_Os04g44110; LOC_Os06g47620; MJP23.12; OSIGBa0131L05.10; OSJNBa0019D11.19; Os04g0521800; Os06g0691400; OsI_16679; OsI |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | metallopeptidase activity | GO:0008237 | Molecular Function | 0.0 | - |
| Sma3 | protein dimerization activity | GO:0046983 | Molecular Function | 0.0 | - |
| Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Peptidase M20 | IPR002933 | - | 0.0 | - |
| Sma3 | IPR010168 | - | 0.0 | - | |
| Sma3 | Peptidase M20, dimerisation | IPR011650 | - | 0.0 | - |
| Sma3 | Amidohydrolase | IPR017439 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT5G54140.1 | ILL3 IAA-leucine-resistant (ILR1)-like 3 chr5:21965833-21967834 FORWARD LENGTH=428 | 4.0e-17 | 71% |
| RefSeq | Arabidopsis thaliana | NP_200225.1 | IAA-amino acid hydrolase ILR1-like 3 [Arabidopsis thaliana] | 5.0e-17 | 71% |
| RefSeq | Populus trichocarpa | XP_002317832.1 | iaa-amino acid hydrolase 6 [Populus trichocarpa] | 5.0e-19 | 77% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LMJ2
Fln msg: Distance to subject end: 222 aas, your sequence is shorter than subject: 59 - 456
Fln protein:
L
Protein Length:
60
Fln nts:
G
Fln Alignment:
GD4IA4402C9I9C___LKGTVRLIFQPAEEGGAGAAYMIREGALGDAEAIFAMHVAPNLSTGTI
B8LMJ2_______________LQGTVRLIFQPAEEGGAGAAHMIREGALGDAEAIFAMHVTPGLSTGAI
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
