|
||||||
|
UniGene Name: sp_v3.0_unigene77129
Length: 243 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene77129
A |
|
Ace file of the UniGene sp_v3.0_unigene77129
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Alcohol dehydrogenase (Fragment) n=7 Tax=Pinaceae RepID=Q43021_PINBN | - | - | 5.0e-06 | 62% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 86% |
| Sma3 | Alcohol dehydrogenase | - | - | 7.377e-15 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Alcohol dehydrogenase. | EC:1.1.1.1 | - | 1.238e-14 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Glycolysis / Gluconeogenesis | 00010 | 1.238e-14 | % | |
| Sma3 | Fatty acid metabolism | 00071 | 1.238e-14 | % | |
| Sma3 | Glycine, serine and threonine metabolism | 00260 | 1.238e-14 | % | |
| Sma3 | Tyrosine metabolism | 00350 | 1.238e-14 | % | |
| Sma3 | Chloroalkane and chloroalkene degradation | 00625 | 1.238e-14 | % | |
| Sma3 | Naphthalene degradation | 00626 | 1.238e-14 | % | |
| Sma3 | Retinol metabolism | 00830 | 1.238e-14 | % | |
| Sma3 | Metabolism of xenobiotics by cytochrome P450 | 00980 | 1.238e-14 | % | |
| Sma3 | Drug metabolism - cytochrome P450 | 00982 | 1.238e-14 | % | |
| Sma3 | Metabolic pathways | 01100 | 1.238e-14 | % | |
| Sma3 | Biosynthesis of secondary metabolites | 01110 | 1.238e-14 | % | |
| Sma3 | S-(hydroxymethyl)glutathione dehydrogenase. | EC:1.1.1.284 | - | 1.617e-09 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Methane metabolism | 00680 | 1.617e-09 | % |
| Source | Gene names |
|---|---|
| Sma3 | ADH; ADH1; ADH2; ADH3; Adh; Adh1; Adh1A; Adh1B; Adh1a; Adh2; Adh3; AdhC3; AdhC4; AdhC5; AdhC7; At1g77120; F22K20.19; GSNOR1; OA_CBa016E12-8; POPTRDRAFT_718546; POPTRDRAFT_782655; POPTRDRAFT_827290; POPTRDRAFT_832230; RCOM_0138590; RCOM_0138830; Wfadh1; ad |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | alcohol dehydrogenase (NAD) activity | GO:0004022 | Molecular Function | 0.0 | - |
| Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
| Sma3 | oxidoreductase activity | GO:0016491 | Molecular Function | 0.0 | - |
| Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Alcohol dehydrogenase superfamily, zinc-type | IPR002085 | - | 0.0 | - |
| Sma3 | Alcohol dehydrogenase, zinc-type, conserved site | IPR002328 | - | 0.0 | - |
| Sma3 | Alcohol dehydrogenase, C-terminal | IPR013149 | - | 0.0 | - |
| Sma3 | Alcohol dehydrogenase GroES-like | IPR013154 | - | 0.0 | - |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9P0H5
Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 148 aas, your sequence is shorter than subject: 81 - 382
Fln protein:
K
Protein Length:
82
Fln nts:
A
Fln Alignment:
GD4IA4402DDSNR___MGATLNVTKPKKG*SVAIFCLXXXXXXXXXXXXXXXDSRIIGIDLNSDRF
A9P0H5_______________MGATLNVAKPKKGSTVAIFGLGGVGLAAAEGARIAGASRIIGIDLNSDRF
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
