UniGene Name: sp_v3.0_unigene77121
Length: 104 nt
![]() |
---|
>sp_v3.0_unigene77121
C |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | putative aquaporin TIP3 [Vitis cinerea var. helleri x Vitis rupestris] | - | - | 5.0e-09 | 88% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 85% |
Sma3 | Tonoplast intrinsic protein | - | - | 5.371e-38 | - |
Source | Gene names |
---|---|
Sma3 | 25.t00032; 26.t00032; 31.t00034; AQP; AQP.1; AQP1; AQP5; AQP6; AT3G16240; Aqp1; At2g36830; At3g16240; At3g26520; At4g01470; At4g17340; At5g47450; C1275ERIPDM; CT179; DIP; F11O4.1; FCAALL.412; FavRB7; GSVIVT00000605001; GSVIVT00012703001; GSVIVT00018548001 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | vacuolar membrane | GO:0005774 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | plant-type vacuole membrane | GO:0009705 | Cellular Component | 0.0 | - |
Sma3 | chloroplast envelope | GO:0009941 | Cellular Component | 0.0 | - |
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | flagellum | GO:0019861 | Cellular Component | 0.0 | - |
Sma3 | nucleic acid binding | GO:0003676 | Molecular Function | 0.0 | - |
Sma3 | transporter activity | GO:0005215 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | methylammonium transmembrane transporter activity | GO:0015200 | Molecular Function | 0.0 | - |
Sma3 | urea transmembrane transporter activity | GO:0015204 | Molecular Function | 0.0 | - |
Sma3 | water channel activity | GO:0015250 | Molecular Function | 0.0 | - |
Sma3 | ammonia transmembrane transporter activity | GO:0051739 | Molecular Function | 0.0 | - |
Sma3 | transport | GO:0006810 | Biological Process | 0.0 | - |
Sma3 | response to stress | GO:0006950 | Biological Process | 0.0 | - |
Sma3 | urea transport | GO:0015840 | Biological Process | 0.0 | - |
Sma3 | water homeostasis | GO:0030104 | Biological Process | 0.0 | - |
Sma3 | defense response to bacterium | GO:0042742 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Major intrinsic protein | IPR000425 | - | 0.0 | - |
Sma3 | Zinc finger, CCHC-type | IPR001878 | - | 0.0 | - |
Sma3 | Aquaporin | IPR012269 | - | 0.0 | - |
Sma3 | Archaeal flagellin, N-terminal | IPR013373 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT3G26520.1 | " TIP2, SITIP, GAMMA-TIP2, TIP1;2 tonoplast intrinsic protein 2 chr3:9722770-9723703 REVERSE LENGTH=253" | 1.0e-13 | 85% |
RefSeq | Arabidopsis thaliana | NP_189283.1 | aquaporin TIP1-2 [Arabidopsis thaliana] | 2.0e-13 | 85% |
RefSeq | Populus trichocarpa | XP_002337227.1 | predicted protein, partial [Populus trichocarpa] | 1.0e-13 | 87% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: C0PT26
Fln msg: Distance to subject end: 29 aas, your sequence is shorter than subject: 34 - 131
Fln protein:
L
Protein Length:
35
Fln nts:
C
Fln Alignment:
GD4IA4402E0MK8___LFVAVSIAANISGGHVNPAVTFGLALGGHITLLR
C0PT26_______________LFVAVAIAANISGGHVNPAVTFGLVLGGQITILK
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain