|
||||||
|
UniGene Name: sp_v3.0_unigene77106
Length: 208 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene77106
A |
|
Ace file of the UniGene sp_v3.0_unigene77106
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Topoisomerase I n=1 Tax=Pisum sativum RepID=O24307_PEA | - | - | 7.0e-26 | 83% |
| FL-Next | sp=DNA topoisomerase 1; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 75% |
| Sma3 | Topoisomerase I | - | - | 2.348e-21 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | DNA topoisomerase. | EC:5.99.1.2 | - | 4.495e-10 | - |
| Source | Gene names |
|---|---|
| Sma3 | At4g26701; At5g55300; At5g55310; CHLREDRAFT_114171; GSVIVT00025855001; GSVIVT00035757001; MTE17.1; OJ1066_B03.125; Os08g0154600; OsI_27847; OsJ_26075; PHATR_13384; PHYPADRAFT_107400; PHYPADRAFT_139910; POPTRDRAFT_1069943; POPTRDRAFT_234922; RCOM_0045870; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | chromosome | GO:0005694 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
| Sma3 | DNA topoisomerase type I activity | GO:0003917 | Molecular Function | 0.0 | - |
| Sma3 | DNA topoisomerase (ATP-hydrolyzing) activity | GO:0003918 | Molecular Function | 0.0 | - |
| Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
| Sma3 | DNA topological change | GO:0006265 | Biological Process | 0.0 | - |
| Sma3 | DNA unwinding involved in replication | GO:0006268 | Biological Process | 0.0 | - |
| Sma3 | RNA-dependent DNA replication | GO:0006278 | Biological Process | 0.0 | - |
| Sma3 | shoot morphogenesis | GO:0010016 | Biological Process | 0.0 | - |
| Sma3 | flower morphogenesis | GO:0048439 | Biological Process | 0.0 | - |
| Sma3 | organ formation | GO:0048645 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Reverse transcriptase | IPR000477 | - | 0.0 | - |
| Sma3 | DNA topoisomerase I, C-terminal | IPR001631 | - | 0.0 | - |
| Sma3 | Endonuclease/exonuclease/phosphatase | IPR005135 | - | 0.0 | - |
| Sma3 | DNA topoisomerase I, DNA binding, eukaryotic-type | IPR008336 | - | 0.0 | - |
| Sma3 | DNA topoisomerase I, DNA binding, mixed alpha/beta motif, eukaryotic-type | IPR013030 | - | 0.0 | - |
| Sma3 | DNA topoisomerase I, C-terminal, eukaryotic-type | IPR013499 | - | 0.0 | - |
| Sma3 | DNA topoisomerase I, catalytic core, eukaryotic-type | IPR013500 | - | 0.0 | - |
| Sma3 | DNA topoisomerase I, catalytic core, alpha-helical subdomain, eukaryotic-type | IPR014711 | - | 0.0 | - |
| Sma3 | DNA topoisomerase I, catalytic core, alpha/beta subdomain, eukaryotic-type | IPR014727 | - | 0.0 | - |
| Sma3 | IPR015706 | - | 0.0 | - | |
| Sma3 | IPR018115 | - | 0.0 | - | |
| Sma3 | DNA topoisomerase I, active site | IPR018521 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT4G26701.1 | " DNA binding;DNA topoisomerase type Is chr4:13467746-13468055 FORWARD LENGTH=69" | 1.0e-27 | 90% |
| RefSeq | Arabidopsis thaliana | NP_001119063.1 | "DNA binding;DNA topoisomerase type Is [Arabidopsis thaliana]" | 2.0e-27 | 90% |
| RefSeq | Populus trichocarpa | XP_002317355.1 | predicted protein, partial [Populus trichocarpa] | 6.0e-24 | 74% |
| Full-Lengther Next Prediction |
|---|
Fln status: Putative C-terminus
Fln database: sp_plants
Fln subject: P30181
Fln msg: STOP codon was not found. Distance to subject end: 2 aas, your sequence is shorter than subject: 69 - 916
Fln protein:
M
Protein Length:
70
Fln nts:
A
Fln Alignment:
GD4IA4402EYVZR___MERDMKTKEDLKTVALGTSKINYLDPRISVAWCKRHEVPIEKIFTKSLLESSLGQWMWTLNSDSD
P30181_______________MERDMHTKEDLKTVALGTSKINYLDPRITVAWCKRHEVPIEKIFTKSLLE----KFAWAMDVEPE
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
