UniGene Name: sp_v3.0_unigene77104
Length: 157 nt
UniGene Fasta |
---|
>sp_v3.0_unigene77104
A |
Ace file of the UniGene sp_v3.0_unigene77104 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Peroxidase-like protein (Fragment) n=19 Tax=Picea sitchensis RepID=E0Z6I6_PICSI | - | - | 6.0e-09 | 70% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 67% |
Sma3 | Peroxidase | - | - | 2.856e-08 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Peroxidase. | EC:1.11.1.7 | - | 1.036e-14 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Phenylalanine metabolism | 00360 | 1.036e-14 | % | |
Sma3 | Methane metabolism | 00680 | 1.036e-14 | % | |
Sma3 | Phenylpropanoid biosynthesis | 00940 | 1.036e-14 | % | |
Sma3 | Biosynthesis of phenylpropanoids | 01061 | 1.036e-14 | % | |
Sma3 | Metabolic pathways | 01100 | 1.036e-14 | % | |
Sma3 | Biosynthesis of secondary metabolites | 01110 | 1.036e-14 | % |
Source | Gene names |
---|---|
Sma3 | GSVIVT00023969001; GSVIVT00024717001; PO5; PO6; POPTRDRAFT_278407; POPTRDRAFT_293120; POPTRDRAFT_547681; POPTRDRAFT_555256; POPTRDRAFT_750497; POPTRDRAFT_814782; POPTRDRAFT_817692; POPTRDRAFT_817694; PRX2; PRXC3; RCOM_0177950; RCOM_0310230; VITISV_022438; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | extracellular region | GO:0005576 | Cellular Component | 0.0 | - |
Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
Sma3 | peroxidase activity | GO:0004601 | Molecular Function | 0.0 | - |
Sma3 | iron ion binding | GO:0005506 | Molecular Function | 0.0 | - |
Sma3 | calcium ion binding | GO:0005509 | Molecular Function | 0.0 | - |
Sma3 | electron carrier activity | GO:0009055 | Molecular Function | 0.0 | - |
Sma3 | heme binding | GO:0020037 | Molecular Function | 0.0 | - |
Sma3 | response to oxidative stress | GO:0006979 | Biological Process | 0.0 | - |
Sma3 | hydrogen peroxide catabolic process | GO:0042744 | Biological Process | 0.0 | - |
Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | GPCR, rhodopsin-like, 7TM | IPR000276 | - | 0.0 | - |
Sma3 | Plant peroxidase | IPR000823 | - | 0.0 | - |
Sma3 | Haem peroxidase, plant/fungal/bacterial | IPR002016 | - | 0.0 | - |
Sma3 | GCN5-like 1 | IPR009395 | - | 0.0 | - |
Sma3 | Peroxidases heam-ligand binding site | IPR019793 | - | 0.0 | - |
Sma3 | Peroxidase, active site | IPR019794 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
RefSeq | Populus trichocarpa | XP_002339602.1 | predicted protein, partial [Populus trichocarpa] | 6.0e-12 | 72% |
Full-Lengther Next Prediction |
---|
Fln status: C-terminus
Fln database: coniferopsida.fasta
Fln subject: B8LP34
Fln msg: your sequence is shorter than subject: 42 - 98
Fln protein:
M
Protein Length:
43
Fln nts:
A
Fln Alignment:
GD4IA4402C27YV___AFFNDFKVSMIKMGNNRPLTGTSGEIRHNCRVVN
B8LP34_______________AFFNDFAAAMVKMGNIKPLTGNNGEIRKNCRKIN
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain