UniGene Name: sp_v3.0_unigene77085
Length: 176 nt
UniGene Fasta |
---|
>sp_v3.0_unigene77085
C |
Ace file of the UniGene sp_v3.0_unigene77085 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Leucine-rich receptor-like protein kinase family protein [Arabidopsis thaliana] sp|O82318.1|Y2579_ARATH RecName: Full=Probably inactive leucine-rich repeat receptor-like protein kinase At2g25790; Flags: Precursor gb|AAC42251.1| putative receptor-like prot | - | - | 4.0e-13 | 61% |
FL-Next | tr=Receptor protein kinase; Pinus sylvestris (Scots pine). | - | - | 0.0 | 54% |
Source | Gene names |
---|---|
Sma3 | AT2G25790; AT4G20140; AT4g20140; At2g25790; F1C12.60; GSVIVT00017157001; GSVIVT00032409001; LRR-RLK; POPTRDRAFT_819535; RCOM_0800450; VITISV_009745; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | protein kinase activity | GO:0004672 | Molecular Function | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | protein tyrosine kinase activity | GO:0004713 | Molecular Function | 0.0 | - |
Sma3 | receptor activity | GO:0004872 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | epidermis development | GO:0008544 | Biological Process | 0.0 | - |
Sma3 | embryo development | GO:0009790 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
Sma3 | Serine-threonine/tyrosine-protein kinase catalytic domain | IPR001245 | - | 0.0 | - |
Sma3 | Leucine-rich repeat | IPR001611 | - | 0.0 | - |
Sma3 | Tyrosine-protein kinase, active site | IPR008266 | - | 0.0 | - |
Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
Sma3 | Leucine-rich repeat-containing N-terminal, type 2 | IPR013210 | - | 0.0 | - |
Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
Sma3 | IPR017442 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT2G25790.1 | Leucine-rich receptor-like protein kinase family protein chr2:11000631-11004031 FORWARD LENGTH=960 | 1.0e-17 | 61% |
RefSeq | Arabidopsis thaliana | NP_180150.1 | Leucine-rich receptor-like protein kinase family protein [Arabidopsis thaliana] | 2.0e-17 | 61% |
RefSeq | Populus trichocarpa | XP_002308597.1 | predicted protein [Populus trichocarpa] | 6.0e-20 | 64% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: Q9FEU2
Fln msg: Distance to subject end: 608 aas, your sequence is shorter than subject: 58 - 1145
Fln protein:
G
Protein Length:
59
Fln nts:
C
Fln Alignment:
GD4IA4402D7UM6___KLQRLEWLYLGYNQLVGEIPSEIGEIASLSHLDLVYNNFTGKIPDSIGNLSNLEE
Q9FEU2_______________KLQKLEKLYLWDNELDGSIPAELGSCSSLKFVDLSTNSLSGSIPDSFGSLKNLSE
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain