UniGene Name: sp_v3.0_unigene76984
Length: 247 nt
![]() |
---|
>sp_v3.0_unigene76984
C |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Myosin XI-F n=1 Tax=Nicotiana benthamiana RepID=B0CN60_NICBE | - | - | 2.0e-34 | 87% |
FL-Next | tr=Myosin XI-F; Nicotiana benthamiana. | - | - | 0.0 | 87% |
Sma3 | Myosin XI, putative | - | - | 4.119e-23 | - |
Source | Gene names |
---|---|
Sma3 | AT4g28710; AT4g33200; At1g17580; At2g20290; At2g31900; At2g33240; At3g58160; At4g33200; At5g20490; At5g43900; CHLREDRAFT_185104; F16A16.180; F20D22.7; F4I10.130; F9D24.70; GSVIVT00003703001; GSVIVT00007440001; GSVIVT00007494001; GSVIVT00011761001; GSVIVT0 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | chromosome | GO:0005694 | Cellular Component | 0.0 | - |
Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | myosin complex | GO:0016459 | Cellular Component | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
Sma3 | motor activity | GO:0003774 | Molecular Function | 0.0 | - |
Sma3 | actin binding | GO:0003779 | Molecular Function | 0.0 | - |
Sma3 | DNA topoisomerase type I activity | GO:0003917 | Molecular Function | 0.0 | - |
Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | protein tyrosine kinase activity | GO:0004713 | Molecular Function | 0.0 | - |
Sma3 | signal transducer activity | GO:0004871 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | actin filament binding | GO:0051015 | Molecular Function | 0.0 | - |
Sma3 | DNA topological change | GO:0006265 | Biological Process | 0.0 | - |
Sma3 | DNA unwinding involved in replication | GO:0006268 | Biological Process | 0.0 | - |
Sma3 | RNA-dependent DNA replication | GO:0006278 | Biological Process | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | signal transduction | GO:0007165 | Biological Process | 0.0 | - |
Sma3 | actin filament-based movement | GO:0030048 | Biological Process | 0.0 | - |
Sma3 | keratinization | GO:0031424 | Biological Process | 0.0 | - |
Sma3 | GO:0045449 | Biological Process | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G20490.1 | XIK, ATXIK, XI-17 Myosin family protein with Dil domain chr5:6927064-6936825 REVERSE LENGTH=1545 | 1.0e-38 | 82% |
RefSeq | Arabidopsis thaliana | NP_001154724.1 | Myosin family protein with Dil domain [Arabidopsis thaliana] | 1.0e-38 | 82% |
RefSeq | Populus trichocarpa | XP_002329057.1 | predicted protein [Populus trichocarpa] | 4.0e-38 | 76% |
![]() |
---|
Fln status: Internal
Fln database: tr_plants
Fln subject: B0CN60
Fln msg: Distance to subject end: 868 aas, your sequence is shorter than subject: 81 - 1569
Fln protein:
I
Protein Length:
82
Fln nts:
C
Fln Alignment:
GD4IA4402EZR4R___ISTTEPHYIRCVKPNGVLKPGIFENFNVLQQLRCGGVLETIRISCAGYPTKRTFDEFLDRFGMLAPEVLEGYDERTAC
B0CN60_______________LSTTEPHYIRCVKPNTVLKPGIFENMNVLNQLRCGGVLEAIRISCAGYPTKRTFDEFLDRFGMLAPDVLDGCDEKSAC
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain