UniGene Name: sp_v3.0_unigene76976
Length: 193 nt
![]() |
---|
>sp_v3.0_unigene76976
A |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Heat shock protein 70 kDa (Fragment) n=2 Tax=Pseudotsuga RepID=C6FCI5_PSEMZ | - | - | 1.0e-07 | 90% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 93% |
Sma3 | Heat shock protein 70 | - | - | 2.805e-16 | - |
Source | Gene names |
---|---|
Sma3 | At1g16030; At3g12580; At5g02490; At5g02500; CHLREDRAFT_185673; GSVIVT00017185001; GSVIVT00024351001; GSVIVT00024357001; HSC-2; HSC-I; HSC70-1; HSC70-2; HSP70; HSP70-1; HSP70-2; HSP70-3; HSP70A; Hsc70; Hsc70-1; Hsp2; Hsp70; LOC_Os03g16860; LOC_Os03g60620; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | cell wall | GO:0005618 | Cellular Component | 0.0 | - |
Sma3 | nucleolus | GO:0005730 | Cellular Component | 0.0 | - |
Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | cytosolic ribosome | GO:0022626 | Cellular Component | 0.0 | - |
Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | ATPase activity, uncoupled | GO:0042624 | Molecular Function | 0.0 | - |
Sma3 | response to stress | GO:0006950 | Biological Process | 0.0 | - |
Sma3 | response to heat | GO:0009408 | Biological Process | 0.0 | - |
Sma3 | response to cold | GO:0009409 | Biological Process | 0.0 | - |
Sma3 | response to virus | GO:0009615 | Biological Process | 0.0 | - |
Sma3 | response to bacterium | GO:0009617 | Biological Process | 0.0 | - |
Sma3 | response to high light intensity | GO:0009644 | Biological Process | 0.0 | - |
Sma3 | response to hydrogen peroxide | GO:0042542 | Biological Process | 0.0 | - |
Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Heat shock protein Hsp70 | IPR001023 | - | 0.0 | - |
Sma3 | Heat shock protein 70 | IPR013126 | - | 0.0 | - |
Sma3 | Heat shock protein 70, conserved site | IPR018181 | - | 0.0 | - |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LRY5
Fln msg: Unexpected STOP codon at 3' end. Distance to subject end: 76 aas, your sequence is shorter than subject: 59 - 652
Fln protein:
L
Protein Length:
60
Fln nts:
A
Fln Alignment:
GD4IA4402ECNR4___YKAEDEELKLKVEAKNSLENYAYNMRNIIFD
B8LRY5_______________YKAEDEELKLKVEAKNSLENYAYNMRNTIRD
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain