UniGene Name: sp_v3.0_unigene76961
Length: 138 nt
UniGene Fasta |
---|
>sp_v3.0_unigene76961
A |
Ace file of the UniGene sp_v3.0_unigene76961 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Homeobox protein n=1 Tax=Gossypium hirsutum RepID=A9PL22_GOSHI | - | - | 9.0e-10 | 78% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 89% |
Sma3 | Homeobox protein, putative | - | - | 1.273e-15 | - |
Source | Gene names |
---|---|
Sma3 | ATHB-1; ATHB-13; ATHB-20; ATHB-3; At1g69780; At3g01220; At3g01470; At5g15150; CPHB-4; CPHB-7; F4P13.2; F8M21_40; GSVIVT00007830001; GSVIVT00012167001; GSVIVT00020757001; GSVIVT00020924001; GSVIVT00037014001; HAHB-5; HAT5; HAT7; HB-7; HB1; HDZ-M48; Hfi22; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | sequence-specific DNA binding transcription factor activity | GO:0003700 | Molecular Function | 0.0 | - |
Sma3 | transcription activator activity | GO:0016563 | Molecular Function | 0.0 | - |
Sma3 | protein homodimerization activity | GO:0042803 | Molecular Function | 0.0 | - |
Sma3 | sequence-specific DNA binding | GO:0043565 | Molecular Function | 0.0 | - |
Sma3 | regulation of transcription, DNA-dependent | GO:0006355 | Biological Process | 0.0 | - |
Sma3 | response to blue light | GO:0009637 | Biological Process | 0.0 | - |
Sma3 | response to salt stress | GO:0009651 | Biological Process | 0.0 | - |
Sma3 | response to auxin stimulus | GO:0009733 | Biological Process | 0.0 | - |
Sma3 | response to sucrose stimulus | GO:0009744 | Biological Process | 0.0 | - |
Sma3 | leaf morphogenesis | GO:0009965 | Biological Process | 0.0 | - |
Sma3 | GO:0045941 | Biological Process | 0.0 | - | |
Sma3 | cotyledon morphogenesis | GO:0048826 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Helix-turn-helix motif | IPR000047 | - | 0.0 | - |
Sma3 | Homeodomain | IPR001356 | - | 0.0 | - |
Sma3 | Leucine zipper, homeobox-associated | IPR003106 | - | 0.0 | - |
Sma3 | IPR012287 | - | 0.0 | - | |
Sma3 | Homeobox, conserved site | IPR017970 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT3G01220.1 | ATHB20, HB20 homeobox protein 20 chr3:73599-75295 FORWARD LENGTH=286 | 8.0e-15 | 78% |
RefSeq | Arabidopsis thaliana | NP_186771.1 | homeobox-leucine zipper protein ATHB-20 [Arabidopsis thaliana] | 1.0e-14 | 78% |
RefSeq | Populus trichocarpa | XP_002323851.1 | predicted protein [Populus trichocarpa] | 1.0e-14 | 78% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NVG4
Fln msg: Unexpected STOP codon at 3' end. Distance to subject end: 221 aas, your sequence is shorter than subject: 44 - 360
Fln protein:
Q
Protein Length:
45
Fln nts:
A
Fln Alignment:
GD4IA4402CZZJA___QVKKLEKSFEVANRLEPETKIQLAKALGLHPRQIAVWF
A9NVG4_______________QVKRLEKSFEVANKLEPERKIQLAKALGLQPRQIAVWF
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain