SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene76917

Length: 300 nt

UniGene Fasta

>sp_v3.0_unigene76917
AAAGTTAAATCTTCCAATTCTTCCCACGACAACAATTGGGTCATTCCCACAGACAGTTGAATTGCGTAGGGTTCGTCGTGAATTCAAGATAAACAAGATTTCAGAGGAAGAATATGTTAGCTGCATCAAGGAAGAAATTGCCAAGGTTGTCAAATTGCAAGAGGACCTTGATATTGATGTGCTTGTGCACGGAGAACCCGAGAGGAATGACATGGTGGAGTACTTTGGAGAACAGCTTCAGGGCTTTGCATTTACGGTCAATGGTTGGTGCAGTCTTATGGATCCCGTTGTGTGAAGCCA

Ace file of the UniGene sp_v3.0_unigene76917

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	Methionine synthase n=3 Tax=Amaranthaceae RepID=Q4H1G2_BETVU	-	-	1.0e-39	91%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	96%
Sma3	Methionine synthase	-	-	1.445e-24	-

Source	ECs	Term	Type	e value	Identity
Sma3	5-methyltetrahydropteroyltriglutamate--homocysteine S-methyltransferase.	EC:2.1.1.14	-	6.61413e-43	-

Source	KEGGs	Term	e value	Identity
Sma3	Cysteine and methionine metabolism	00270	6.61413e-43	%
Sma3	Selenocompound metabolism	00450	6.61413e-43	%
Sma3	Biosynthesis of plant hormones	01070	6.61413e-43	%
Sma3	Metabolic pathways	01100	6.61413e-43	%
Sma3	Biosynthesis of secondary metabolites	01110	6.61413e-43	%

Source	Gene names
Sma3	At3g03780; At5g17920; At5g20980; BvMS1; CHLREDRAFT_154307; CIMS; GSVIVT00003836001; GSVIVT00017439001; HvMS; LOC_Os12g42884; MET; METE; MPI7.9; MS1; MS2; MS3; MS4; Os12g0623900; Os12g0624000; OsI_39179; OsI_39180; OsJ_36927; PHATRDRAFT_28056; PHYPADRAFT_2

Source	GOs	Term	Type	Identity
Sma3	cytoplasm	GO:0005737	Cellular Component	-
Sma3	peroxisome	GO:0005777	Cellular Component	-
Sma3	cytosol	GO:0005829	Cellular Component	-
Sma3	ribosome	GO:0005840	Cellular Component	-
Sma3	plasma membrane	GO:0005886	Cellular Component	-
Sma3	chloroplast	GO:0009507	Cellular Component	-
Sma3	chloroplast stroma	GO:0009570	Cellular Component	-
Sma3	chloroplast envelope	GO:0009941	Cellular Component	-
Sma3	apoplast	GO:0048046	Cellular Component	-
Sma3	structural constituent of ribosome	GO:0003735	Molecular Function	-
Sma3	5-methyltetrahydropteroyltriglutamate-homocysteine S-methyltransferase activity	GO:0003871	Molecular Function	-
Sma3	copper ion binding	GO:0005507	Molecular Function	-
Sma3	zinc ion binding	GO:0008270	Molecular Function	-
Sma3	methionine synthase activity	GO:0008705	Molecular Function	-
Sma3	translation	GO:0006412	Biological Process	-
Sma3	methionine biosynthetic process	GO:0009086	Biological Process	-
Sma3	response to salt stress	GO:0009651	Biological Process	-
Sma3	response to cadmium ion	GO:0046686	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	Ribosomal protein S7e	IPR000554	-	-
Sma3	Methionine synthase, vitamin-B12 independent	IPR002629	-	-
Sma3	Cobalamin-independent methionine synthase	IPR006276	-	-
Sma3	Cobalamin (vitamin B12)-independent methionine synthase MetE, N-terminal	IPR013215	-	-

Source	Species	ID	Description	Identity
ATG	Arabidoptis thaliana	AT3G03780.1	ATMS2, MS2 methionine synthase 2 chr3:957602-960740 FORWARD LENGTH=765	87%
RefSeq	Arabidopsis thaliana	NP_187028.1	methionine synthase 2 [Arabidopsis thaliana]	87%
RefSeq	Populus trichocarpa	XP_002313635.1	vitamin-b12 independent methionine synthase, 5-methyltetrahydropteroyltriglutamate-homocysteine [Populus trichocarpa]	85%

Full-Lengther Next Prediction

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: B8LPY2

Fln msg: Unexpected STOP codon at 3' end. Distance to subject end: 240 aas, your sequence is shorter than subject: 98 - 766

Fln protein: KLNLPILPTTTIGSFPQTVELRRVRREFKINKISEEEYVSCIKEEIAKVVKLQEDLDIDVLVHGEPERNDMVEYFGEQLQGFAFTVNGWCSLMDPVV*

Protein Length: 99

Fln nts: AAAGTTAAATCTTCCAATTCTTCCCACGACAACAATTGGGTCATTCCCACAGACAGTTGAATTGCGTAGGGTTCGTCGTGAATTCAAGATAAACAAGATTTCAGAGGAAGAATATGTTAGCTGCATCAAGGAAGAAATTGCCAAGGTTGTCAAATTGCAAGAGGACCTTGATATTGATGTGCTTGTGCACGGAGAACCCGAGAGGAATGACATGGTGGAGTACTTTGGAGAACAGCTTCAGGGCTTTGCATTTACGGTCAATGGTTGGTGCAGTCTTATGGATCCCGTTGTGTGAAGCCA

Fln Alignment:

GD4IA4402ELFF3___KLNLPILPTTTIGSFPQTVELRRVRREFKINKISEEEYVSCIKEEIAKVVKLQEDLDIDVLVHGEPERNDMVEYFGEQLQGFAFTVNGW
B8LPY2_______________KLNLPILPTTTIGSFPQTVELRRVRREYKINKISEDEYVSSIKEEIAKVVKLQEDLDIDVLVHGEPERNDMVEYFGEQLQGFAFTVNGW

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain