UniGene Name: sp_v3.0_unigene76905
Length: 237 nt
![]() |
---|
>sp_v3.0_unigene76905
A |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Pentatricopeptide repeat protein (Fragment) n=1 Tax=Lepidogyna hodgsoniae RepID=B3U1Z5_9MARC | - | - | 1.0e-26 | 74% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 77% |
Sma3 | Pentatricopeptide repeat protein | - | - | 0.0 | - |
Source | Gene names |
---|---|
Sma3 | At1g09410; At1g47580; At2g15690; At2g22070; At3g57430; At4g33170; At5g09950; At5g16860; B1032F05.19; F14J9.7; F16N3.14; F2K13_10; F4I10.100; F9O13.24; GSVIVT00002068001; GSVIVT00003383001; GSVIVT00004068001; GSVIVT00005426001; GSVIVT00006467001; GSVIVT000 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | ribosome | GO:0005840 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
Sma3 | structural constituent of ribosome | GO:0003735 | Molecular Function | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | methyltransferase activity | GO:0008168 | Molecular Function | 0.0 | - |
Sma3 | deaminase activity | GO:0019239 | Molecular Function | 0.0 | - |
Sma3 | DNA methylation | GO:0006306 | Biological Process | 0.0 | - |
Sma3 | translation | GO:0006412 | Biological Process | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | metabolic process | GO:0008152 | Biological Process | 0.0 | - |
Sma3 | purine ribonucleoside monophosphate biosynthetic process | GO:0009168 | Biological Process | 0.0 | - |
Sma3 | thiamine biosynthetic process | GO:0009228 | Biological Process | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G47580.1 | Pentatricopeptide repeat (PPR) superfamily protein chr1:17485668-17486387 FORWARD LENGTH=239 | 9.0e-31 | 61% |
RefSeq | Arabidopsis thaliana | NP_175189.2 | putative lipoyltransferase [Arabidopsis thaliana] | 1.0e-30 | 61% |
RefSeq | Populus trichocarpa | XP_002326908.1 | predicted protein [Populus trichocarpa] | 3.0e-32 | 68% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5AAE0
Fln msg: Distance to subject end: 18 aas, your sequence is shorter than subject: 78 - 246
Fln protein:
V
Protein Length:
79
Fln nts:
A
Fln Alignment:
GD4IA4402EKOGN___GYVPDTGFALHDLDQEQKEHSLCHHSEKLAIAFGLLSTSPGISLRIIKNLRVCGDCHTAIKFISRLDGREIIVRD
D5AAE0_______________GYVPDTNFVLHDVEMEQKEHSLYHHSEKLAIAFGLISTLPGLPVRIIKNLRVCGDCHTATKFISKIVEREIIIRD
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain