UniGene Name: sp_v3.0_unigene76873
Length: 193 nt
![]() |
---|
>sp_v3.0_unigene76873
C |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | pentatricopeptide repeat-containing protein [Arabidopsis thaliana] sp|Q9LNU6.2|PPR53_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At1g20230 gb|AEE29953.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] | - | - | 2.0e-17 | 58% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 84% |
Sma3 | Pentatricopeptide repeat-containing protein, putative | - | - | 4.698e-13 | - |
Source | Gene names |
---|---|
Sma3 | At1g20230; At2g01510; At2g22070; At2g36730; At3g23330; At4g02750; At4g38010; At5g06540; At5g19020; At5g43790; At5g59600; B1358B12.23; F13K3.13; F15M7.7; F20D10.130; F2I9.13; F2O15.13; GSVIVT00001532001; GSVIVT00001706001; GSVIVT00002423001; GSVIVT00003900 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | intracellular | GO:0005622 | Cellular Component | 0.0 | - |
Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
Sma3 | mitochondrial inner membrane | GO:0005743 | Cellular Component | 0.0 | - |
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | ubiquitin thiolesterase activity | GO:0004221 | Molecular Function | 0.0 | - |
Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | methyltransferase activity | GO:0008168 | Molecular Function | 0.0 | - |
Sma3 | protein transporter activity | GO:0008565 | Molecular Function | 0.0 | - |
Sma3 | ubiquitin-dependent protein catabolic process | GO:0006511 | Biological Process | 0.0 | - |
Sma3 | metabolic process | GO:0008152 | Biological Process | 0.0 | - |
Sma3 | protein transport | GO:0015031 | Biological Process | 0.0 | - |
Sma3 | RNA metabolic process | GO:0016070 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Armadillo | IPR000225 | - | 0.0 | - |
Sma3 | Beta-lactamase, class-A/D | IPR000871 | - | 0.0 | - |
Sma3 | Peptidase C12, ubiquitin carboxyl-terminal hydrolase 1 | IPR001578 | - | 0.0 | - |
Sma3 | Pentatricopeptide repeat | IPR002885 | - | 0.0 | - |
Sma3 | Mitochondrial inner membrane translocase subunit Tim17/Tim22/Tim23/peroxisomal protein PMP24 | IPR003397 | - | 0.0 | - |
Sma3 | Domain of unknown function DUF221 | IPR003864 | - | 0.0 | - |
Sma3 | MIF4G-like, type 3 | IPR003890 | - | 0.0 | - |
Sma3 | Initiation factor eIF-4 gamma, MA3 | IPR003891 | - | 0.0 | - |
Sma3 | Armadillo-like helical | IPR011989 | - | 0.0 | - |
Sma3 | Tetratricopeptide-like helical | IPR011990 | - | 0.0 | - |
Sma3 | Methyltransferase type 11 | IPR013216 | - | 0.0 | - |
Sma3 | Asp/Glu racemase, active site | IPR018187 | - | 0.0 | - |
Sma3 | WD40 repeat, conserved site | IPR019775 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G20230.1 | Pentatricopeptide repeat (PPR) superfamily protein chr1:7009570-7011852 FORWARD LENGTH=760 | 1.0e-22 | 58% |
RefSeq | Arabidopsis thaliana | NP_173449.1 | pentatricopeptide repeat-containing protein [Arabidopsis thaliana] | 1.0e-22 | 58% |
RefSeq | Populus trichocarpa | XP_002324074.1 | predicted protein [Populus trichocarpa] | 1.0e-22 | 60% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LQA8
Fln msg: Distance to subject end: 203 aas, your sequence is shorter than subject: 63 - 795
Fln protein:
A
Protein Length:
64
Fln nts:
C
Fln Alignment:
GD4IA4402DGYMC___AILTACCHAGLVDQGWQYFECMKLDHGLAPKLEHYACLVDLLGRAGHLAEAYDIIKKMPLEPD
B8LQA8_______________AILTACSHAGLVDQGLQYFQCMKSDYGLAPKLEHYACLVDLLGRAGHLDEANGIIKNMSLEPD
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain