|
||||||
|
UniGene Name: sp_v3.0_unigene76731
Length: 222 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
 UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene76731
G |
|
Ace file of the UniGene sp_v3.0_unigene76731 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | MDR-like ABC transporter n=1 Tax=Taxus cuspidata RepID=E6Y0T0_TAXCU | - | - | 5.0e-21 | 78% |
| FL-Next | tr=MDR-like ABC transporter; Taxus cuspidata (Japanese yew). | - | - | 0.0 | 45% |
| Sma3 | Multidrug resistance protein 1, 2, putative | - | - | 3.535e-35 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Phosphate-transporting ATPase. | EC:3.6.3.27 | - | 4.979e-16 | - |
| Sma3 | Xenobiotic-transporting ATPase. | EC:3.6.3.44 | - | 1.055e-28 | - |
| Source | Gene names |
|---|---|
| Sma3 | At1g02520; At1g02530; At2g47000; At3g55320; At3g62150; At4g01820; At4g01830; At5g46540; CMDR1; Cjmdr1; F14M4.17; GSVIVT00000633001; GSVIVT00003368001; GSVIVT00003375001; GSVIVT00003377001; GSVIVT00018550001; GSVIVT00019727001; GSVIVT00019729001; GSVIVT000 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | xenobiotic-transporting ATPase activity | GO:0008559 | Molecular Function | 0.0 | - |
| Sma3 | ATPase activity | GO:0016887 | Molecular Function | 0.0 | - |
| Sma3 | ATPase activity, coupled to transmembrane movement of substances | GO:0042626 | Molecular Function | 0.0 | - |
| Sma3 | transport | GO:0006810 | Biological Process | 0.0 | - |
| Sma3 | gravitropism | GO:0009630 | Biological Process | 0.0 | - |
| Sma3 | auxin mediated signaling pathway | GO:0009734 | Biological Process | 0.0 | - |
| Sma3 | response to cytokinin stimulus | GO:0009735 | Biological Process | 0.0 | - |
| Sma3 | auxin efflux | GO:0010315 | Biological Process | 0.0 | - |
| Sma3 | basipetal auxin transport | GO:0010540 | Biological Process | 0.0 | - |
| Sma3 | root hair elongation | GO:0048767 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Peptidase, cysteine peptidase active site | IPR000169 | - | 0.0 | - |
| Sma3 | ABC transporter, transmembrane domain | IPR001140 | - | 0.0 | - |
| Sma3 | F-box domain, cyclin-like | IPR001810 | - | 0.0 | - |
| Sma3 | ABC transporter-like | IPR003439 | - | 0.0 | - |
| Sma3 | AAA+ ATPase domain | IPR003593 | - | 0.0 | - |
| Sma3 | Vacuolar fusion protein MON1 | IPR004353 | - | 0.0 | - |
| Sma3 | Phosphopantetheine attachment site | IPR006162 | - | 0.0 | - |
| Sma3 | Leucine-rich repeat 2 | IPR013101 | - | 0.0 | - |
| Sma3 | IPR013596 | - | 0.0 | - | |
| Sma3 | ABC transporter, conserved site | IPR017871 | - | 0.0 | - |
| Sma3 | ABC transporter, integral membrane type 1 | IPR017940 | - | 0.0 | - |
| Sma3 | HTH domain AraC-type, conserved site | IPR018062 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT2G47000.1 | MDR4, PGP4, ABCB4, ATPGP4 ATP binding cassette subfamily B4 chr2:19310008-19314750 REVERSE LENGTH=1286 | 1.0e-21 | 74% |
| RefSeq | Arabidopsis thaliana | NP_182223.1 | ABC transporter B family member 4 [Arabidopsis thaliana] | 2.0e-21 | 74% |
| RefSeq | Populus trichocarpa | XP_002314333.1 | multidrug/pheromone exporter, MDR family, ABC transporter family, partial [Populus trichocarpa] | 5.0e-22 | 74% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: E6Y0T0
Fln msg: warning!, putative chimeric sequence! or repetitive structureDistance to subject end: 858 aas, your sequence is shorter than subject: 74 - 1316
Fln protein:
E
Protein Length:
75
Fln nts:
G
Fln Alignment:
GD4IA4402DREGN___EDIQGDIELKDGHFGYPARPxxxGFSLEISRGTTPALVGESGSGKTTILSLIERFYDPQAGEVLLDSVNIKHFQ
E6Y0T0_______________DNVKGDIEFQHVSFKYPTRPxxxGFSLEIPSGTTAALVGESGSGKSTVISLVERFYDPQAGEVLIDGINIKKFQ
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
