UniGene Name: sp_v3.0_unigene76635
Length: 214 nt
![]() |
---|
>sp_v3.0_unigene76635
A |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Sugar carrier protein A n=6 Tax=Andropogoneae RepID=B6TMZ9_MAIZE | - | - | 5.0e-25 | 91% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 100% |
Sma3 | Sugar transporter, putative | - | - | 9.75598e-41 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | 2-alkenal reductase. | EC:1.3.1.74 | - | 1.011e-23 | - |
Source | Gene names |
---|---|
Sma3 | AGAA.1; At1g11260; At1g34580; At1g50310; At1g77210; At3g05960; At3g19930; At3g19940; At4g02050; At4g21480; At5g23270; At5g26250; At5g26340; At5g61520; B1008E06.22-1; B1317D11.119-1; B1317D11.119-2; F12K21.8; F14I3.9; F18E5.100; F2O10.8; F9D12.17; F9D12.9; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | transporter activity | GO:0005215 | Molecular Function | 0.0 | - |
Sma3 | sugar:hydrogen symporter activity | GO:0005351 | Molecular Function | 0.0 | - |
Sma3 | high-affinity hydrogen:glucose symporter activity | GO:0005358 | Molecular Function | 0.0 | - |
Sma3 | sucrose:hydrogen symporter activity | GO:0008506 | Molecular Function | 0.0 | - |
Sma3 | monosaccharide transmembrane transporter activity | GO:0015145 | Molecular Function | 0.0 | - |
Sma3 | substrate-specific transmembrane transporter activity | GO:0022891 | Molecular Function | 0.0 | - |
Sma3 | rRNA N-glycosylase activity | GO:0030598 | Molecular Function | 0.0 | - |
Sma3 | transport | GO:0006810 | Biological Process | 0.0 | - |
Sma3 | carbohydrate transport | GO:0008643 | Biological Process | 0.0 | - |
Sma3 | sucrose transport | GO:0015770 | Biological Process | 0.0 | - |
Sma3 | negative regulation of translation | GO:0017148 | Biological Process | 0.0 | - |
Sma3 | carbohydrate transmembrane transport | GO:0034219 | Biological Process | 0.0 | - |
Sma3 | transmembrane transport | GO:0055085 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Ribosome-inactivating protein | IPR001574 | - | 0.0 | - |
Sma3 | Sugar/inositol transporter | IPR003663 | - | 0.0 | - |
Sma3 | General substrate transporter | IPR005828 | - | 0.0 | - |
Sma3 | Sugar transporter, conserved site | IPR005829 | - | 0.0 | - |
Sma3 | ABC transporter, conserved site | IPR017871 | - | 0.0 | - |
Sma3 | Ribosomal protein S2, conserved site | IPR018130 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT4G02050.1 | STP7 sugar transporter protein 7 chr4:898387-900095 REVERSE LENGTH=513 | 6.0e-30 | 87% |
RefSeq | Arabidopsis thaliana | NP_192114.1 | sugar transport protein 7 [Arabidopsis thaliana] | 8.0e-30 | 87% |
RefSeq | Populus trichocarpa | XP_002325158.1 | predicted protein [Populus trichocarpa] | 8.0e-29 | 85% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5AB82
Fln msg: Unexpected STOP codon at 3' end. Distance to subject end: 46 aas, your sequence is shorter than subject: 69 - 226
Fln protein:
T
Protein Length:
70
Fln nts:
A
Fln Alignment:
GD4IA4402D4SCL___AAFGWSWGPLGWTVPSEIFPLETRSAGQAITVSVNLLFTFAIAQAFLYLLCTFKYGIF
D5AB82_______________AAFGWSWGPLGWTVPSEIFPLETRSAGQAITVSVNLLFTFAIAQAFLYLLCTFKYGIF
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain