|
||||||
|
UniGene Name: sp_v3.0_unigene76627
Length: 205 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene76627
G |
|
Ace file of the UniGene sp_v3.0_unigene76627
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Cytochrome P450 CYP94B1 n=4 Tax=Arabidopsis RepID=Q9FMV7_ARATH | - | - | 7.0e-20 | 67% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 91% |
| Sma3 | Cytochrome P450 | - | - | 1.348e-20 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Unspecific monooxygenase. | EC:1.14.14.1 | - | 5.996e-20 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Fatty acid metabolism | 00071 | 5.996e-20 | % | |
| Sma3 | Steroid hormone biosynthesis | 00140 | 5.996e-20 | % | |
| Sma3 | Caffeine metabolism | 00232 | 5.996e-20 | % | |
| Sma3 | Tryptophan metabolism | 00380 | 5.996e-20 | % | |
| Sma3 | Arachidonic acid metabolism | 00590 | 5.996e-20 | % | |
| Sma3 | Linoleic acid metabolism | 00591 | 5.996e-20 | % | |
| Sma3 | Aminobenzoate degradation | 00627 | 5.996e-20 | % | |
| Sma3 | Retinol metabolism | 00830 | 5.996e-20 | % | |
| Sma3 | Metabolism of xenobiotics by cytochrome P450 | 00980 | 5.996e-20 | % | |
| Sma3 | Drug metabolism - cytochrome P450 | 00982 | 5.996e-20 | % | |
| Sma3 | Drug metabolism - other enzymes | 00983 | 5.996e-20 | % | |
| Sma3 | Biosynthesis of alkaloids derived from shikimate pathway | 01063 | 5.996e-20 | % | |
| Sma3 | Metabolic pathways | 01100 | 5.996e-20 | % |
| Source | Gene names |
|---|---|
| Sma3 | A_IG005I10.21; At1g01600; At1g01600/F22L4_10; At1g34540; At1g63710; At2g27690; At2g27690/F15K20.21; At2g44890; At2g45970; At3g01900; At3g48520; At3g56630; At4g00360; At5g58860; At5g63450; At5g63450/MLE2_8; B0103C08-B0602B01.11; B1096A10.16; CYP704C1; CYP8 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
| Sma3 | microsome | GO:0005792 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | monooxygenase activity | GO:0004497 | Molecular Function | 0.0 | - |
| Sma3 | iron ion binding | GO:0005506 | Molecular Function | 0.0 | - |
| Sma3 | GO:0008393 | Molecular Function | 0.0 | - | |
| Sma3 | electron carrier activity | GO:0009055 | Molecular Function | 0.0 | - |
| Sma3 | heme binding | GO:0020037 | Molecular Function | 0.0 | - |
| Sma3 | fatty acid metabolic process | GO:0006631 | Biological Process | 0.0 | - |
| Sma3 | suberin biosynthetic process | GO:0010345 | Biological Process | 0.0 | - |
| Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | RNA helicase, ATP-dependent, DEAD-box, conserved site | IPR000629 | - | 0.0 | - |
| Sma3 | Cytochrome P450 | IPR001128 | - | 0.0 | - |
| Sma3 | F-box domain, cyclin-like | IPR001810 | - | 0.0 | - |
| Sma3 | Cytochrome P450, E-class, group I | IPR002401 | - | 0.0 | - |
| Sma3 | Cytochrome P450, E-class, group IV | IPR002403 | - | 0.0 | - |
| Sma3 | EGF-like region, conserved site | IPR013032 | - | 0.0 | - |
| Sma3 | F-box associated interaction domain | IPR017451 | - | 0.0 | - |
| Sma3 | Cytochrome P450, conserved site | IPR017972 | - | 0.0 | - |
| Sma3 | IPR017973 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT5G63450.1 | CYP94B1 cytochrome P450, family 94, subfamily B, polypeptide 1 chr5:25408987-25410519 REVERSE LENGTH=510 | 5.0e-26 | 67% |
| RefSeq | Arabidopsis thaliana | NP_201150.1 | cytochrome P450, family 94, subfamily B, polypeptide 1 [Arabidopsis thaliana] | 7.0e-26 | 67% |
| RefSeq | Populus trichocarpa | XP_002300103.1 | cytochrome P450 [Populus trichocarpa] | 2.0e-24 | 64% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5A7Y6
Fln msg: Distance to subject end: 412 aas, your sequence is shorter than subject: 68 - 559
Fln protein:
Q
Protein Length:
69
Fln nts:
G
Fln Alignment:
GD4IA4402EBDOE___QTIVLERLGGIRTVLTANPENVEHILKTRFDNYPKGEPFTAILHDLLGNGIFNSDGDAWKLQRKVASY
D5A7Y6_______________QTIVVERLGGIRTVLTANPENLEHILKTRFDNYPKGNPFTAILHDLLGKGIFNADGDTWKLQRKVASY
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
