UniGene Name: sp_v3.0_unigene76626
Length: 193 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene76626
A |
Ace file of the UniGene sp_v3.0_unigene76626
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Receptor-like kinase n=1 Tax=Marchantia polymorpha RepID=A7VM40_MARPO | - | - | 1.0e-18 | 72% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 56% |
| Sma3 | Receptor protein kinase-like | - | - | 2.669e-07 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Non-specific protein-tyrosine kinase. | EC:2.7.10.2 | - | 1.116e-11 | - |
| Source | Gene names |
|---|---|
| Sma3 | AT4g00330; AT4g39110; AT5G48740; AT5G49760; AT5G49770; A_IG005I10.8; At1g30570; At2g21480; At2g39360; At3g46290; At4g00330; At4g39110; At5g49760; At5g49760/K2I5_13; F12M12.260; F18L15.10; F19H22.210; F5I10.8; GSVIVT00006178001; GSVIVT00019573001; GSVIVT00 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | nucleic acid binding | GO:0003676 | Molecular Function | 0.0 | - |
| Sma3 | protein kinase activity | GO:0004672 | Molecular Function | 0.0 | - |
| Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
| Sma3 | protein tyrosine kinase activity | GO:0004713 | Molecular Function | 0.0 | - |
| Sma3 | receptor activity | GO:0004872 | Molecular Function | 0.0 | - |
| Sma3 | calcium ion binding | GO:0005509 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT5G48740.1 | Leucine-rich repeat protein kinase family protein chr5:19765324-19769314 REVERSE LENGTH=895 | 4.0e-23 | 68% |
| RefSeq | Arabidopsis thaliana | NP_199685.2 | putative LRR receptor-like serine/threonine-protein kinase [Arabidopsis thaliana] | 5.0e-23 | 68% |
| RefSeq | Populus trichocarpa | XP_002301786.1 | predicted protein [Populus trichocarpa] | 5.0e-24 | 67% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5AAA3
Fln msg: Distance to subject end: 147 aas, your sequence is shorter than subject: 64 - 458
Fln protein:
N
Protein Length:
65
Fln nts:
A
Fln Alignment:
GD4IA4402EKGMO___GEASHVTTMVKGTAGYLDPEYFSTERLTDKSDVYSFGVVLLEIICGRTPIDAKLSVDKLNII
D5AAA3_______________GDKTHVSTRVMGTYGYCAPEYAMTGQLTIKSDVYSFGVVLLELITGRKAIDNSRSAGENNLV

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta