UniGene Name: sp_v3.0_unigene76582
Length: 245 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
UniGene Fasta (sense) |
---|
>sp_v3.0_unigene76582
T |
Ace file of the UniGene sp_v3.0_unigene76582 (antisense) |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Unassigned protein | - | - | 0.0 | - |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 70% |
Sma3 | Tetratricopeptide-like helical | - | - | 1.155e-07 | - |
Source | Gene names |
---|---|
Sma3 | At1g15510; At1g25360; At2g22070; At4g18750; At4g19191; At5g39350; At5g44230; B1032F05.19; B1080A02.28; F28A21.160; F4F7.25; GSVIVT00000887001; GSVIVT00001177001; GSVIVT00001706001; GSVIVT00003060001; GSVIVT00004379001; GSVIVT00006467001; GSVIVT00006973001 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
Sma3 | methyltransferase activity | GO:0008168 | Molecular Function | 0.0 | - |
Sma3 | metabolic process | GO:0008152 | Biological Process | 0.0 | - |
Sma3 | phloem or xylem histogenesis | GO:0010087 | Biological Process | 0.0 | - |
Sma3 | leaf vascular tissue pattern formation | GO:0010305 | Biological Process | 0.0 | - |
Sma3 | cotyledon vascular tissue pattern formation | GO:0010588 | Biological Process | 0.0 | - |
Sma3 | leaf development | GO:0048366 | Biological Process | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G15510.1 | ATECB2, ECB2, VAC1 Tetratricopeptide repeat (TPR)-like superfamily protein chr1:5329111-5331711 FORWARD LENGTH=866 | 7.0e-26 | 56% |
RefSeq | Arabidopsis thaliana | NP_173004.1 | pentatricopeptide repeat-containing protein [Arabidopsis thaliana] | 9.0e-26 | 56% |
RefSeq | Populus trichocarpa | XP_002302000.1 | predicted protein [Populus trichocarpa] | 7.0e-28 | 63% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5ADG9
Fln msg: Distance to subject end: 139 aas, your sequence is shorter than subject: 81 - 312
Fln protein:
L
Protein Length:
82
Fln nts:
T
Fln Alignment:
GD4IA4402EBR14___LSEAQKFIEVMPLEPDADVWGALLSACRIHCNIKLGEQVAERLFNLKPTKIGYYVLLANMYAAAGRWDDVAKVRMLMKDR
D5ADG9_______________LNEAWDFIEKMPIEPGASVWGAFLGSCRIHCNIELGERVAELLLNLDPDNAGYYVLLSNIYAAAGRWDDVAKVRKMMKEK
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain