UniGene Name: sp_v3.0_unigene76356
Length: 206 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene76356
G |
Ace file of the UniGene sp_v3.0_unigene76356
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | auxin response factor 2 [Oryza sativa] | - | - | 3.0e-11 | 60% |
| FL-Next | tr=Putative auxin response factor 3/4; Pinus pinaster (Maritime pine). | - | - | 0.0 | 80% |
| Sma3 | Auxin response factor, putative | - | - | 4.892e-23 | - |
| Source | Gene names |
|---|---|
| Sma3 | ARF1; ARF11; ARF12; ARF16; ARF17; ARF19; ARF2; ARF21; ARF23; ARF24; ARF25; ARF4; ARF5; ARF6; ARF6A; ARF6B; ARF7; ARF7A; ARF7B; ARF8; ARF9; AT4G23980; At1g19220; At1g19850; At1g30330; At1g59750; At4g23980; At5g20730; At5g37020; At5g62000; BIP; CsARF1; CsAR |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
| Sma3 | sequence-specific DNA binding transcription factor activity | GO:0003700 | Molecular Function | 0.0 | - |
| Sma3 | transcription activator activity | GO:0016563 | Molecular Function | 0.0 | - |
| Sma3 | protein dimerization activity | GO:0046983 | Molecular Function | 0.0 | - |
| Sma3 | regulation of transcription, DNA-dependent | GO:0006355 | Biological Process | 0.0 | - |
| Sma3 | negative regulation of cell proliferation | GO:0008285 | Biological Process | 0.0 | - |
| Sma3 | gravitropism | GO:0009630 | Biological Process | 0.0 | - |
| Sma3 | phototropism | GO:0009638 | Biological Process | 0.0 | - |
| Sma3 | response to ethylene stimulus | GO:0009723 | Biological Process | 0.0 | - |
| Sma3 | response to hormone stimulus | GO:0009725 | Biological Process | 0.0 | - |
| Sma3 | auxin mediated signaling pathway | GO:0009734 | Biological Process | 0.0 | - |
| Sma3 | blue light signaling pathway | GO:0009785 | Biological Process | 0.0 | - |
| Sma3 | flower development | GO:0009908 | Biological Process | 0.0 | - |
| Sma3 | positive regulation of flower development | GO:0009911 | Biological Process | 0.0 | - |
| Sma3 | longitudinal axis specification | GO:0009942 | Biological Process | 0.0 | - |
| Sma3 | fruit dehiscence | GO:0010047 | Biological Process | 0.0 | - |
| Sma3 | leaf senescence | GO:0010150 | Biological Process | 0.0 | - |
| Sma3 | floral organ abscission | GO:0010227 | Biological Process | 0.0 | - |
| Sma3 | leaf vascular tissue pattern formation | GO:0010305 | Biological Process | 0.0 | - |
| Sma3 | lateral root primordium development | GO:0010386 | Biological Process | 0.0 | - |
| Sma3 | GO:0016481 | Biological Process | 0.0 | - | |
| Sma3 | negative regulation of transcription, DNA-dependent | GO:0045892 | Biological Process | 0.0 | - |
| Sma3 | root development | GO:0048364 | Biological Process | 0.0 | - |
| Sma3 | leaf development | GO:0048366 | Biological Process | 0.0 | - |
| Sma3 | ovule development | GO:0048481 | Biological Process | 0.0 | - |
| Sma3 | meristem development | GO:0048507 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Aminotransferase, class-II, pyridoxal-phosphate binding site | IPR001917 | - | 0.0 | - |
| Sma3 | AUX/IAA protein | IPR003311 | - | 0.0 | - |
| Sma3 | B3 DNA binding domain | IPR003340 | - | 0.0 | - |
| Sma3 | Auxin response factor | IPR010525 | - | 0.0 | - |
| Sma3 | Aux/IAA-ARF-dimerisation | IPR011525 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT5G62000.1 | ARF2, ARF1-BP, HSS, ORE14 auxin response factor 2 chr5:24910859-24914680 FORWARD LENGTH=859 | 2.0e-14 | 66% |
| RefSeq | Arabidopsis thaliana | NP_001190591.1 | auxin response factor 2 [Arabidopsis thaliana] | 2.0e-14 | 66% |
| RefSeq | Populus trichocarpa | XP_002318767.1 | predicted protein [Populus trichocarpa] | 1.0e-14 | 67% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: E1UHY2
Fln msg: Distance to subject end: 589 aas, your sequence is shorter than subject: 68 - 919
Fln protein:
R
Protein Length:
69
Fln nts:
G
Fln Alignment:
GD4IA4402D9CIN___RDENGELRLGIRRAARQQCVIPSSVLSSRSMHLGLLXXXXXXXXTKSMFHIYYNPR
E1UHY2_______________RDENGELRLGIRRASQQQSSVPSSVLSSHGIHSGVLAAVAHAVATKSMFHIYYNPR

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta