UniGene Name: sp_v3.0_unigene76316
Length: 244 nt
UniGene Fasta |
---|
>sp_v3.0_unigene76316
A |
Ace file of the UniGene sp_v3.0_unigene76316 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | alanine:glyoxylate aminotransferase 2 homolog [Arabidopsis thaliana] | - | - | 8.0e-27 | 81% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 92% |
Sma3 | Alanine-glyoxylate aminotransferase, putative | - | - | 1.113e-08 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Alanine--glyoxylate transaminase. | EC:2.6.1.44 | - | 4.089e-15 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Alanine, aspartate and glutamate metabolism | 00250 | 4.089e-15 | % | |
Sma3 | Glycine, serine and threonine metabolism | 00260 | 4.089e-15 | % | |
Sma3 | Metabolic pathways | 01100 | 4.089e-15 | % |
Source | Gene names |
---|---|
Sma3 | AGT2; AGT3; At2g38400; At3g08860; At4g39660; CHLREDRAFT_133057; GSVIVT00019422001; GSVIVT00023979001; GSVIVT00037451001; LOC_Os03g07570; LOC_Os03g21960; Os03g0171900; Os03g0338000; Os05g0475400; OsI_10205; OsI_11479; OsI_20323; OsJ_09593; OsJ_10768; OsJ_1 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | alanine-glyoxylate transaminase activity | GO:0008453 | Molecular Function | 0.0 | - |
Sma3 | transaminase activity | GO:0008483 | Molecular Function | 0.0 | - |
Sma3 | pyridoxal phosphate binding | GO:0030170 | Molecular Function | 0.0 | - |
Sma3 | photorespiration | GO:0009853 | Biological Process | 0.0 | - |
Sma3 | arginine catabolic process to glutamate | GO:0019544 | Biological Process | 0.0 | - |
Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Aminotransferase class-III | IPR005814 | - | 0.0 | - |
Sma3 | Pyridoxal phosphate-dependent transferase, major region, subdomain 1 | IPR015421 | - | 0.0 | - |
Sma3 | Pyridoxal phosphate-dependent transferase, major region, subdomain 2 | IPR015422 | - | 0.0 | - |
Sma3 | Peptidase S1/S6, chymotrypsin/Hap, active site | IPR018114 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT4G39660.1 | AGT2 alanine:glyoxylate aminotransferase 2 chr4:18406797-18409262 FORWARD LENGTH=476 | 4.0e-34 | 81% |
RefSeq | Arabidopsis thaliana | NP_568064.1 | alanine:glyoxylate aminotransferase 2 [Arabidopsis thaliana] | 6.0e-34 | 81% |
RefSeq | Populus trichocarpa | XP_002310591.1 | predicted protein [Populus trichocarpa] | 2.0e-36 | 89% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NW66
Fln msg: Unexpected STOP codon at 3' end. Distance to subject end: 137 aas, your sequence is shorter than subject: 74 - 482
Fln protein:
R
Protein Length:
75
Fln nts:
A
Fln Alignment:
GD4IA4402DEUEM___VGGAVELAPGYLRAAYDIVRKAGGVCISDEVQTGFGRMGSHYWGFETQGVIPDIVTVAKGMGNGLP
A9NW66_______________VGGAVELAPGYLPAVYDSVRKAGGVCISDEVQTGFGRMGSHYWGFETQGVIPDIVTMAKGIGNGLP
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain