UniGene Name: sp_v3.0_unigene76276
Length: 229 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
UniGene Fasta (sense) |
---|
>sp_v3.0_unigene76276
T |
Ace file of the UniGene sp_v3.0_unigene76276 (antisense) |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | lectin protein kinase-like protein [Arabidopsis thaliana] sp|Q9XID3.1|Y1343_ARATH RecName: Full=G-type lectin S-receptor-like serine/threonine-protein kinase At1g34300; Flags: Precursor gb|AAD39605.1|AC007454_4 Contains similarity to gi|479356 protein kin | - | - | 8.0e-22 | 69% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 75% |
Sma3 | Putative S-receptor kinase | - | - | 2.066e-07 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | EC:2.7.11.3- | - | 2.86e-06 | - |
Source | Gene names |
---|---|
Sma3 | At1g34300; B1099D03.46; B1099D03.51; DUPR11.18; F23M19.5; GSVIVT00000338001; GSVIVT00001733001; GSVIVT00001735001; GSVIVT00018598001; GSVIVT00018599001; H0525E10.1; H0525E10.6; H0525E10.7; H0525E10.8; LOC_Os03g62180; LOC_Os10g01100; LOC_Os11g10280; LOC_Os |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | cell surface | GO:0009986 | Cellular Component | 0.0 | - |
Sma3 | phospholipase C activity | GO:0004629 | Molecular Function | 0.0 | - |
Sma3 | protein kinase activity | GO:0004672 | Molecular Function | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | protein tyrosine kinase activity | GO:0004713 | Molecular Function | 0.0 | - |
Sma3 | receptor activity | GO:0004872 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | sugar binding | GO:0005529 | Molecular Function | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | lipid metabolic process | GO:0006629 | Biological Process | 0.0 | - |
Sma3 | GO:0007242 | Biological Process | 0.0 | - | |
Sma3 | recognition of pollen | GO:0048544 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | GPCR, rhodopsin-like, 7TM | IPR000276 | - | 0.0 | - |
Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
Sma3 | S-locus glycoprotein | IPR000858 | - | 0.0 | - |
Sma3 | Phospholipase C, phosphatidylinositol-specific , X domain | IPR000909 | - | 0.0 | - |
Sma3 | Serine-threonine/tyrosine-protein kinase catalytic domain | IPR001245 | - | 0.0 | - |
Sma3 | Bulb-type lectin domain | IPR001480 | - | 0.0 | - |
Sma3 | IPR001899 | - | 0.0 | - | |
Sma3 | Apple-like | IPR003609 | - | 0.0 | - |
Sma3 | Epidermal growth factor-like | IPR006210 | - | 0.0 | - |
Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
Sma3 | EGF-like region, conserved site | IPR013032 | - | 0.0 | - |
Sma3 | PAN-2 domain | IPR013227 | - | 0.0 | - |
Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
Sma3 | IPR017442 | - | 0.0 | - | |
Sma3 | Peptidase S26A, signal peptidase I, serine active site | IPR019756 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G34300.1 | lectin protein kinase family protein chr1:12503450-12505939 FORWARD LENGTH=829 | 2.0e-27 | 69% |
RefSeq | Arabidopsis thaliana | NP_174690.1 | lectin protein kinase-like protein [Arabidopsis thaliana] | 2.0e-27 | 69% |
RefSeq | Populus trichocarpa | XP_002327224.1 | predicted protein, partial [Populus trichocarpa] | 9.0e-32 | 72% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NM60
Fln msg: Distance to subject end: 100 aas, your sequence is shorter than subject: 76 - 431
Fln protein:
L
Protein Length:
77
Fln nts:
T
Fln Alignment:
GD4IA4402C7J0B___MTSVRGTRGYLAPEWLANLPITTKSDVFSYGMVLLEIISGKRNFD
A9NM60_______________VTGVRGTPGYMAPEWLLGAGITSKSDVFSYGMVLLEIISGRRNVD
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain