UniGene Name: sp_v3.0_unigene76249
Length: 200 nt
UniGene Fasta |
---|
>sp_v3.0_unigene76249
C |
Ace file of the UniGene sp_v3.0_unigene76249 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Xyloglucan endotransglucosylase/hydrolase 14 n=1 Tax=Actinidia deliciosa RepID=C0IRH3_ACTDE | - | - | 3.0e-25 | 83% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 94% |
Sma3 | Xyloglucan endotransglucosylase/hydrolase protein 2, putative | - | - | 2.689e-10 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Xyloglucan:xyloglucosyl transferase. | EC:2.4.1.207 | - | 3.891e-16 | - |
Source | Gene names |
---|---|
Sma3 | AT2G01850; At1g14720; At1g32170; At2g01850; At4g18990; B1040D06.30-1; B1053A04.26-1; EXGT-A2; EXGT-A3; F10B6.12; F10B6.29; F13C5.160; F3C3.5; GSVIVT00015670001; GSVIVT00028840001; GSVIVT00030638001; LOC_Os03g13570; LOC_Os03g63760; LOC_Os10g02770; LOC_Os10 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | cell wall | GO:0005618 | Cellular Component | 0.0 | - |
Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
Sma3 | hydrolase activity, hydrolyzing O-glycosyl compounds | GO:0004553 | Molecular Function | 0.0 | - |
Sma3 | transferase activity | GO:0016740 | Molecular Function | 0.0 | - |
Sma3 | xyloglucan:xyloglucosyl transferase activity | GO:0016762 | Molecular Function | 0.0 | - |
Sma3 | carbohydrate metabolic process | GO:0005975 | Biological Process | 0.0 | - |
Sma3 | cellular glucan metabolic process | GO:0006073 | Biological Process | 0.0 | - |
Sma3 | cellular cell wall organization | GO:0007047 | Biological Process | 0.0 | - |
Sma3 | phloem or xylem histogenesis | GO:0010087 | Biological Process | 0.0 | - |
Sma3 | fruit development | GO:0010154 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | ATPase, F1/V1/A1 complex, alpha/beta subunit, nucleotide-binding domain | IPR000194 | - | 0.0 | - |
Sma3 | Glycoside hydrolase, family 16 | IPR000757 | - | 0.0 | - |
Sma3 | Glycoside hydrolase, family 16, active site | IPR008263 | - | 0.0 | - |
Sma3 | Xyloglucan endo-transglycosylase, C-terminal | IPR010713 | - | 0.0 | - |
Sma3 | Concanavalin A-like lectin/glucanase, subgroup | IPR013320 | - | 0.0 | - |
Sma3 | Xyloglucan endotransglucosylase/hydrolase | IPR016455 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT2G01850.1 | EXGT-A3, XTH27, ATXTH27 endoxyloglucan transferase A3 chr2:385374-387138 FORWARD LENGTH=333 | 8.0e-32 | 77% |
RefSeq | Arabidopsis thaliana | NP_178294.1 | xyloglucan:xyloglucosyl transferase [Arabidopsis thaliana] | 1.0e-31 | 77% |
RefSeq | Populus trichocarpa | XP_002311545.1 | predicted protein [Populus trichocarpa] | 8.0e-33 | 79% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NUC4
Fln msg: Distance to subject end: 192 aas, your sequence is shorter than subject: 66 - 352
Fln protein:
S
Protein Length:
67
Fln nts:
C
Fln Alignment:
GD4IA4402C1GJP___SMKLPDDYTAGVV-AFYTSNGDMFQGTHDELDFEFLGNIRGKEWRIQTNVYGNGSTAYGREERYTLW
A9NUC4_______________SIKLPDDYTAGVVVAFYTSNGDIFQGTHDELDFEFLGNIRGKEWRIQTNVYGNGSTAFGREERYTLW
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain