UniGene Name: sp_v3.0_unigene76141
Length: 226 nt
UniGene Fasta |
---|
>sp_v3.0_unigene76141
A |
Ace file of the UniGene sp_v3.0_unigene76141 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Chaperone protein DnaJ n=1 Tax=Desulfobacterium autotrophicum HRM2 RepID=C0QLU9_DESAH | - | - | 3.0e-15 | 71% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 69% |
Sma3 | Protein SIS1, putative | - | - | 1.325e-10 | - |
Source | Gene names |
---|---|
Sma3 | AT4g28480; At1g10350; At2g20560; At3g08910; At3g47940; At3g62600; At4g28480; At5g01390; At5g01390/T10O8_100; At5g25530; CHLREDRAFT_298; CHLREDRAFT_96566; CPIP2a; CPIP2b; DNJ35; DNJ7; F20O9.160; F23H11.4; F26K9_30; GSVIVT00000072001; GSVIVT00003050001; GSV |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | endoplasmic reticulum lumen | GO:0005788 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | nucleic acid binding | GO:0003676 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | heat shock protein binding | GO:0031072 | Molecular Function | 0.0 | - |
Sma3 | unfolded protein binding | GO:0051082 | Molecular Function | 0.0 | - |
Sma3 | protein folding | GO:0006457 | Biological Process | 0.0 | - |
Sma3 | response to stress | GO:0006950 | Biological Process | 0.0 | - |
Sma3 | response to heat | GO:0009408 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Heat shock protein DnaJ, cysteine-rich domain | IPR001305 | - | 0.0 | - |
Sma3 | Chlorophyll A-B binding protein, plant | IPR001344 | - | 0.0 | - |
Sma3 | Tetratricopeptide TPR-1 | IPR001440 | - | 0.0 | - |
Sma3 | Heat shock protein DnaJ, N-terminal | IPR001623 | - | 0.0 | - |
Sma3 | Zinc finger, CCHC-type | IPR001878 | - | 0.0 | - |
Sma3 | Chaperone DnaJ, C-terminal | IPR002939 | - | 0.0 | - |
Sma3 | Heat shock protein DnaJ | IPR003095 | - | 0.0 | - |
Sma3 | Tetratricopeptide-like helical | IPR011990 | - | 0.0 | - |
Sma3 | Chaperone DnaJ | IPR012724 | - | 0.0 | - |
Sma3 | Tetratricopeptide repeat-containing domain | IPR013026 | - | 0.0 | - |
Sma3 | Tetratricopeptide TPR2 | IPR013105 | - | 0.0 | - |
Sma3 | IPR015609 | - | 0.0 | - | |
Sma3 | Heat shock protein DnaJ, conserved site | IPR018253 | - | 0.0 | - |
Sma3 | Ribosomal protein S14, conserved site | IPR018271 | - | 0.0 | - |
Sma3 | Tetratricopeptide repeat | IPR019734 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G10350.1 | DNAJ heat shock family protein chr1:3393595-3394860 REVERSE LENGTH=349 | 7.0e-18 | 66% |
RefSeq | Arabidopsis thaliana | NP_172506.1 | putative DNAJ heat-shock protein [Arabidopsis thaliana] | 9.0e-18 | 66% |
RefSeq | Populus trichocarpa | XP_002329800.1 | predicted protein [Populus trichocarpa] | 3.0e-18 | 71% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LLM7
Fln msg: Distance to subject end: 244 aas, your sequence is shorter than subject: 75 - 336
Fln protein:
K
Protein Length:
76
Fln nts:
A
Fln Alignment:
GD4IA4402C6SLH___KEDIKKSYRKLAMKFHPDRNKGNK-EAEEKFKSISQAYNVLSDEKQRQIYDQY
B8LLM7_______________EDDLKKAYRKLAMKWHPDKNPNNKKEAEAKFKQISEAYEVLSDNQKRQIYDQY
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain