|
||||||
|
UniGene Name: sp_v3.0_unigene76122
Length: 223 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene76122
A |
|
Ace file of the UniGene sp_v3.0_unigene76122
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | cytochrome P450 monooxygenase CYP71D64 [Medicago truncatula] | - | - | 8.0e-17 | 57% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 71% |
| Sma3 | Cytochrome P450-dependent monooxygenase | - | - | 6.381e-06 | - |
| Source | Gene names |
|---|---|
| Sma3 | Ald5H; CYP71D10; CYP71D64; CYP736A8v1; CYP736A8v2; CYP736A8v4; F5H; GSVIVT00017652001; GSVIVT00017653001; GSVIVT00017654001; GSVIVT00019414001; GSVIVT00019415001; GSVIVT00026288001; GSVIVT00035950001; GSVIVT00036840001; LOC_Os03g39650; LOC_Os10g36848; OJ1 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
| Sma3 | monooxygenase activity | GO:0004497 | Molecular Function | 0.0 | - |
| Sma3 | iron ion binding | GO:0005506 | Molecular Function | 0.0 | - |
| Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
| Sma3 | electron carrier activity | GO:0009055 | Molecular Function | 0.0 | - |
| Sma3 | heme binding | GO:0020037 | Molecular Function | 0.0 | - |
| Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
| Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Protease inhibitor I4, serpin | IPR000215 | - | 0.0 | - |
| Sma3 | Cytochrome P450 | IPR001128 | - | 0.0 | - |
| Sma3 | Integrase, catalytic core | IPR001584 | - | 0.0 | - |
| Sma3 | Zinc finger, CCHC-type | IPR001878 | - | 0.0 | - |
| Sma3 | Cytochrome P450, E-class, group I | IPR002401 | - | 0.0 | - |
| Sma3 | Cytochrome P450, E-class, group IV | IPR002403 | - | 0.0 | - |
| Sma3 | Reverse transcriptase, RNA-dependent DNA polymerase | IPR013103 | - | 0.0 | - |
| Sma3 | Cytochrome P450, conserved site | IPR017972 | - | 0.0 | - |
| Sma3 | IPR017973 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT4G36220.1 | FAH1, CYP84A1 ferulic acid 5-hydroxylase 1 chr4:17137584-17139619 REVERSE LENGTH=520 | 3.0e-20 | 54% |
| RefSeq | Arabidopsis thaliana | NP_195345.1 | ferulic acid 5-hydroxylase 1 [Arabidopsis thaliana] | 4.0e-20 | 54% |
| RefSeq | Populus trichocarpa | XP_002310011.1 | predicted protein [Populus trichocarpa] | 7.0e-22 | 57% |
| Full-Lengther Next Prediction |
|---|
Fln status: Putative C-terminus
Fln database: coniferopsida.fasta
Fln subject: B8LQY0
Fln msg: STOP codon was not found. Distance to subject end: 0 aas, your sequence is shorter than subject: 73 - 512
Fln protein:
C
Protein Length:
74
Fln nts:
A
Fln Alignment:
GD4IA4402D15QR___EWIPFGAGRRMCPGEQLGMLLVQFPLAQLLHCFDWTLPDKMNGQELDMSEKF-GITVGREHDLSAVPTPRLTV
B8LQY0_______________EWIPFGAGRRGCPGQQLGMLVVEFGMAQLLHCFNWKLPDEINGQELDMVERFNGLTLPRAHELLAVPTPRLSL
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
