UniGene Name: sp_v3.0_unigene76097
Length: 222 nt
![]() |
---|
>sp_v3.0_unigene76097
T |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | pfam00069, Pkinase, Protein kinase domain | - | - | 2.0e-10 | 36% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 42% |
Sma3 | Leucine Rich Repeat family protein | - | - | 1.667e-15 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | 2-alkenal reductase. | EC:1.3.1.74 | - | 1.485e-11 | - |
Source | Gene names |
---|---|
Sma3 | At2g24130; B1307A11.12; GSVIVT00003509001; GSVIVT00004217001; GSVIVT00010786001; GSVIVT00014285001; GSVIVT00014914001; GSVIVT00017170001; GSVIVT00018762001; GSVIVT00018765001; GSVIVT00018766001; GSVIVT00018767001; GSVIVT00021489001; GSVIVT00021491001; GSV |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | chromatin | GO:0000785 | Cellular Component | 0.0 | - |
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | proton-transporting V-type ATPase, V0 domain | GO:0033179 | Cellular Component | 0.0 | - |
Sma3 | nucleic acid binding | GO:0003676 | Molecular Function | 0.0 | - |
Sma3 | chromatin binding | GO:0003682 | Molecular Function | 0.0 | - |
Sma3 | aspartic-type endopeptidase activity | GO:0004190 | Molecular Function | 0.0 | - |
Sma3 | protein kinase activity | GO:0004672 | Molecular Function | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | protein tyrosine kinase activity | GO:0004713 | Molecular Function | 0.0 | - |
Sma3 | receptor activity | GO:0004872 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | hydrogen ion transmembrane transporter activity | GO:0015078 | Molecular Function | 0.0 | - |
Sma3 | chromatin assembly or disassembly | GO:0006333 | Biological Process | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
Sma3 | ATP synthesis coupled proton transport | GO:0015986 | Biological Process | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT2G24130.1 | Leucine-rich receptor-like protein kinase family protein chr2:10258148-10261220 FORWARD LENGTH=980 | 1.0e-18 | 54% |
RefSeq | Arabidopsis thaliana | NP_179990.1 | putative leucine-rich repeat transmembrane protein kinase [Arabidopsis thaliana] | 2.0e-18 | 54% |
RefSeq | Populus trichocarpa | XP_002317008.1 | predicted protein, partial [Populus trichocarpa] | 1.0e-25 | 60% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: C0PRI9
Fln msg: Distance to subject end: 331 aas, your sequence is shorter than subject: 73 - 656
Fln protein:
E
Protein Length:
74
Fln nts:
T
Fln Alignment:
GD4IA4402EIWRQ___EDLVKATQGFNEANLVGVGSFGSVYKGILHDGTEVAVKVLKLQNEEAYKSFNTECDVLQRIRHRNLIRIISSC
C0PRI9_______________EDLEAATNGFSRTNLLGQGGFGYVYKGILPGSKTIAVKQLKVGGSQGEREFQAEVEIISRVHHRHLVSLVGYC
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain