UniGene Name: sp_v3.0_unigene76031
Length: 229 nt
![]() |
---|
>sp_v3.0_unigene76031
G |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | S-adenosyl methionine synthetase 2 (Fragment) n=10 Tax=Pinaceae RepID=Q5EK82_PINTA | - | - | 7.0e-32 | 97% |
FL-Next | sp=S-adenosylmethionine synthase; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 100% |
Sma3 | S-adenosylmethionine synthetase | - | - | 4.17e-31 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Methionine adenosyltransferase. | EC:2.5.1.6 | - | 0.0 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Cysteine and methionine metabolism | 00270 | 0.0 | % | |
Sma3 | Biosynthesis of plant hormones | 01070 | 0.0 | % | |
Sma3 | Metabolic pathways | 01100 | 0.0 | % | |
Sma3 | Biosynthesis of secondary metabolites | 01110 | 0.0 | % |
Source | Gene names |
---|---|
Sma3 | AT4G01850; AdoMet1; AdoMet3; AdoMet4; AdoMet5; AdoMet6; AdoMet_e2; At2g36880; At3g17390; CC2188; CHLRE_182408; CHRSAMS; GSVIVT00022173001; GSVIVT00038475001; LOC_Os01g18860; MAT; METK; METK-1; METK-2; METK1; METK2; METK3; METK4; METK5; METM; MGD8.23; MSAM |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | cell wall | GO:0005618 | Cellular Component | 0.0 | - |
Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
Sma3 | magnesium ion binding | GO:0000287 | Molecular Function | 0.0 | - |
Sma3 | serine-type endopeptidase activity | GO:0004252 | Molecular Function | 0.0 | - |
Sma3 | methionine adenosyltransferase activity | GO:0004478 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | potassium ion binding | GO:0030955 | Molecular Function | 0.0 | - |
Sma3 | cobalt ion binding | GO:0050897 | Molecular Function | 0.0 | - |
Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
Sma3 | one-carbon metabolic process | GO:0006730 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Peptidase S14, ClpP | IPR001907 | - | 0.0 | - |
Sma3 | S-adenosylmethionine synthetase | IPR002133 | - | 0.0 | - |
Sma3 | Eukaryotic rRNA processing | IPR008610 | - | 0.0 | - |
Sma3 | Heavy-metal-associated, conserved site | IPR017969 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT4G01850.1 | SAM-2, MAT2, SAM2, AtSAM2 S-adenosylmethionine synthetase 2 chr4:796298-797479 REVERSE LENGTH=393 | 3.0e-31 | 91% |
RefSeq | Arabidopsis thaliana | NP_001078345.1 | S-adenosylmethionine synthase 2 [Arabidopsis thaliana] | 4.0e-31 | 91% |
RefSeq | Populus trichocarpa | XP_002326202.1 | s-adenosylmethionine synthetase 6 [Populus trichocarpa] | 1.0e-31 | 89% |
![]() |
---|
Fln status: Putative C-terminus
Fln database: coniferopsida.fasta
Fln subject: B8LNX2
Fln msg: Warning!, your query overlaps and the subject is separated, STOP codon was not found. Distance to subject end: 13 aas, your sequence is shorter than subject: 76 - 393
Fln protein:
G
Protein Length:
77
Fln nts:
G
Fln Alignment:
GD4IA4402EN85I___GAYIVRQAAKSIVAAGLARRCLVQVSYAIGxxxxxxxxxxxxxxxxxxxxxxxEIIKENFDFRPGMITINLDLKRGGNGRFQKTAAYGHFGRDDPDFTW
B8LNX2_______________GAYIVRQAAKSIVAAGLARRCLVQVSYAIGxxxxxxxxxxxxxxxxxxxxxxxELIKENFDFRPGMITINLDLKRGGNGRFQKTAAYGHFGRDDPDFTW
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain