UniGene Name: sp_v3.0_unigene75988
Length: 246 nt
![]() |
---|
>sp_v3.0_unigene75988
C |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Tubulin beta-1 chain (Fragment) n=1 Tax=Ascaris suum RepID=F1LHV5_ASCSU | - | - | 3.0e-33 | 77% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 76% |
Sma3 | Tubulin beta-1 chain | - | - | 6.343e-10 | - |
Source | Gene names |
---|---|
Sma3 | At1g20010; GSVIVT00014415001; GSVIVT00017820001; GSVIVT00029807001; LOC_Os03g56810; Os02g0167300; Os03g0780600; OsI_05997; OsI_13743; OsJ_05524; OsJ_12810; PHYPADRAFT_110341; PHYPADRAFT_117822; PHYPADRAFT_121199; PHYPADRAFT_165677; PHYPADRAFT_186458; PHYP |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | cell wall | GO:0005618 | Cellular Component | 0.0 | - |
Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
Sma3 | microtubule | GO:0005874 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | protein complex | GO:0043234 | Cellular Component | 0.0 | - |
Sma3 | GTPase activity | GO:0003924 | Molecular Function | 0.0 | - |
Sma3 | structural molecule activity | GO:0005198 | Molecular Function | 0.0 | - |
Sma3 | GTP binding | GO:0005525 | Molecular Function | 0.0 | - |
Sma3 | microtubule-based movement | GO:0007018 | Biological Process | 0.0 | - |
Sma3 | protein polymerization | GO:0051258 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Tubulin | IPR000217 | - | 0.0 | - |
Sma3 | Beta tubulin | IPR002453 | - | 0.0 | - |
Sma3 | Tubulin/FtsZ, GTPase domain | IPR003008 | - | 0.0 | - |
Sma3 | Beta tubulin, autoregulation binding site | IPR013838 | - | 0.0 | - |
Sma3 | Tubulin, conserved site | IPR017975 | - | 0.0 | - |
Sma3 | Tubulin/FtsZ, 2-layer sandwich domain | IPR018316 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G20010.1 | TUB5 tubulin beta-5 chain chr1:6938033-6940481 REVERSE LENGTH=449 | 4.99997e-41 | 75% |
RefSeq | Arabidopsis thaliana | NP_564101.1 | tubulin beta-5 chain [Arabidopsis thaliana] | 5.99994e-41 | 75% |
RefSeq | Populus trichocarpa | XP_002336980.1 | tubulin, beta chain, partial [Populus trichocarpa] | 1.99965e-42 | 75% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5ABQ9
Fln msg: Distance to subject end: 33 aas, your sequence is shorter than subject: 81 - 445
Fln protein:
Q
Protein Length:
82
Fln nts:
C
Fln Alignment:
GD4IA4402D4WVP___VQTKNRAYFVEWIPNNVLTAVCDVPPKGMKMSVTFIGNNTSIQELFRRVSEQFSRMYKRKAFLHWYTSEGMDELEFTEAE
D5ABQ9_______________VQNKNSSYFVEWIPNNVKSSACDIPPKGLSMSSTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAE
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain