|
||||||
|
UniGene Name: sp_v3.0_unigene75792
Length: 221 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene75792
G |
|
Ace file of the UniGene sp_v3.0_unigene75792
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | UDP-glucuronic acid decarboxylase 3 [Populus tomentosa] | - | - | 1.0e-11 | 82% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 97% |
| Sma3 | UDP-glucuronic acid decarboxylase | - | - | 7.088e-17 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | UDP-glucuronate decarboxylase. | EC:4.1.1.35 | - | 3.50325e-44 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Starch and sucrose metabolism | 00500 | 3.50325e-44 | % | |
| Sma3 | Amino sugar and nucleotide sugar metabolism | 00520 | 3.50325e-44 | % | |
| Sma3 | Metabolic pathways | 01100 | 3.50325e-44 | % |
| Source | Gene names |
|---|---|
| Sma3 | AT2G47650; AT3G46440; At2g28760; At3g46440; At3g53520; At3g62830; At5g59290; B1012D10.32; CHLREDRAFT_135101; D18; F18L15.160; F26K9_260; F4P12.220; F4P12_220; GAD1; GSVIVT00018513001; GSVIVT00023112001; GSVIVT00024364001; GSVIVT00028008001; GSVIVT00033009 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Golgi membrane | GO:0000139 | Cellular Component | 0.0 | - |
| Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
| Sma3 | Golgi apparatus | GO:0005794 | Cellular Component | 0.0 | - |
| Sma3 | cytosol | GO:0005829 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | catalytic activity | GO:0003824 | Molecular Function | 0.0 | - |
| Sma3 | UDP-glucuronate decarboxylase activity | GO:0048040 | Molecular Function | 0.0 | - |
| Sma3 | coenzyme binding | GO:0050662 | Molecular Function | 0.0 | - |
| Sma3 | D-xylose metabolic process | GO:0042732 | Biological Process | 0.0 | - |
| Sma3 | cellular metabolic process | GO:0044237 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | NAD-dependent epimerase/dehydratase | IPR001509 | - | 0.0 | - |
| Sma3 | NAD(P)-binding domain | IPR016040 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT3G46440.1 | UXS5 UDP-XYL synthase 5 chr3:17089268-17091611 REVERSE LENGTH=341 | 4.0e-16 | 82% |
| RefSeq | Arabidopsis thaliana | NP_001030820.1 | UDP-XYL synthase 5 [Arabidopsis thaliana] | 5.0e-16 | 82% |
| RefSeq | Populus trichocarpa | XP_002298368.1 | predicted protein [Populus trichocarpa] | 4.0e-16 | 82% |
| Full-Lengther Next Prediction |
|---|
Fln status: C-terminus
Fln database: coniferopsida.fasta
Fln subject: A9NUD0
Fln msg: your sequence is shorter than subject: 43 - 351
Fln protein:
M
Protein Length:
44
Fln nts:
G
Fln Alignment:
GD4IA4402ECDPH___MTENTPDDPRMRKPDITKAKTLLGWEPKVSLREGLPR
A9NUD0_______________ITENTPDDPRMRKPDITKAKTLLGWEPKVSLREGLPR
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
