SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene75708

Length: 279 nt

UniGene Fasta

>sp_v3.0_unigene75708
GTTCAAGGTGAGGATCAATTCCTTGCCAGAATCTATCAGGAGAAGATCAGATGCTTACAATGCTCACGAAGAGATTCGTTCAAAGAGAGCACAGATTGAATTAGGAGGTGATCCTACAGAGCCACTGAAGGTATTGAAGGCTACATGGATGGCAGATGGGACTCACTGGCCTGGGACATGGATTTCCCCTGACAGAGAACATTCCAGGGGAGATCATCCGGGCATAATTCAGGTGATGTTGGCTCCTCCAAGCTCAGAACCTCTGATGGGATGCTCTGA

Ace file of the UniGene sp_v3.0_unigene75708

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	Cellulose synthase-like D3-1, glycosyltransferase family 2 protein n=2 Tax=Selaginella moellendorffii RepID=D8R581_SELML	-	-	2.0e-39	82%
FL-Next	sp=Cellulose synthase-like protein D4; Arabidopsis thaliana (Mouse-ear cress).	-	-	0.0	71%
Sma3	Cellulose synthase-like protein D4	-	-	3.81e-11	-

Source	ECs	Term	Type	e value	Identity
Sma3	Transferases, Glycosyltransferases, Hexosyltransferases.	EC:2.4.1.-	-	1.926e-22	-

Source	KEGGs	Term	Type	e value	Identity
Sma3	Fructose and mannose metabolism	00051		1.926e-22	%
Sma3	N-Glycan biosynthesis	00510		1.926e-22	%
Sma3	Mucin type O-Glycan biosynthesis	00512		1.926e-22	%
Sma3	Various types of N-glycan biosynthesis	00513		1.926e-22	%
Sma3	Other types of O-glycan biosynthesis	00514		1.926e-22	%
Sma3	Biosynthesis of 12-, 14- and 16-membered macrolides	00522		1.926e-22	%
Sma3	Glycosaminoglycan biosynthesis - keratan sulfate	00533		1.926e-22	%
Sma3	Lipopolysaccharide biosynthesis	00540		1.926e-22	%
Sma3	Peptidoglycan biosynthesis	00550		1.926e-22	%
Sma3	Glycerolipid metabolism	00561		1.926e-22	%
Sma3	Glycosylphosphatidylinositol(GPI)-anchor biosynthesis	00563		1.926e-22	%
Sma3	Sphingolipid metabolism	00600		1.926e-22	%
Sma3	Glycosphingolipid biosynthesis - lacto and neolacto series	00601		1.926e-22	%
Sma3	Glycosphingolipid biosynthesis - globo series	00603		1.926e-22	%
Sma3	Glycosphingolipid biosynthesis - ganglio series	00604		1.926e-22	%
Sma3	Carotenoid biosynthesis	00906		1.926e-22	%
Sma3	Zeatin biosynthesis	00908		1.926e-22	%
Sma3	Flavonoid biosynthesis	00941		1.926e-22	%
Sma3	Anthocyanin biosynthesis	00942		1.926e-22	%
Sma3	Flavone and flavonol biosynthesis	00944		1.926e-22	%
Sma3	Stilbenoid, diarylheptanoid and gingerol biosynthesis	00945		1.926e-22	%
Sma3	Betalain biosynthesis	00965		1.926e-22	%
Sma3	Biosynthesis of type II polyketide products	01057		1.926e-22	%
Sma3	Metabolic pathways	01100		1.926e-22	%
Sma3	Biosynthesis of secondary metabolites	01110		1.926e-22	%
Sma3	Cellulose synthase (UDP-forming).	EC:2.4.1.12	-	1.46e-12	-

Source	KEGGs	Term	Type	e value	Identity
Sma3	Starch and sucrose metabolism	00500		1.46e-12	%

Source	Gene names
Sma3	At1g02730; At1g32180; At2g33100; At3g03050; At4g38190; At5g16910; CSLD1; CSLD2; CSLD3; CSLD4; CSLD5; CSLD6; CslD1; F20D10.310; F22D16.26; F25I18.16; F2K13.60; F3C3.4; GSVIVT00014029001; GSVIVT00015671001; GSVIVT00028062001; GSVIVT00031177001; KJK; LOC_Os0

Source	GOs	Term	Type	Identity
Sma3	Golgi membrane	GO:0000139	Cellular Component	-
Sma3	endoplasmic reticulum	GO:0005783	Cellular Component	-
Sma3	plasma membrane	GO:0005886	Cellular Component	-
Sma3	membrane	GO:0016020	Cellular Component	-
Sma3	integral to membrane	GO:0016021	Cellular Component	-
Sma3	integral to Golgi membrane	GO:0030173	Cellular Component	-
Sma3	cellulose synthase (UDP-forming) activity	GO:0016760	Molecular Function	-
Sma3	1,4-beta-D-xylan synthase activity	GO:0047517	Molecular Function	-
Sma3	cellular cell wall organization	GO:0007047	Biological Process	-
Sma3	response to cold	GO:0009409	Biological Process	-
Sma3	pollen germination	GO:0009846	Biological Process	-
Sma3	cellulose biosynthetic process	GO:0030244	Biological Process	-
Sma3	cell wall biogenesis	GO:0042546	Biological Process	-
Sma3	shoot development	GO:0048367	Biological Process	-
Sma3	root hair elongation	GO:0048767	Biological Process	-

Source	InterPros	Term	Type	e value	Identity
Sma3	Cellulose synthase	IPR005150	-	0.0	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	AT4G38190.1	ATCSLD4, CSLD4 cellulose synthase like D4 chr4:17910096-17913641 REVERSE LENGTH=1111	3.00004e-41	71%
RefSeq	Arabidopsis thaliana	NP_195532.1	cellulose synthase-like protein D4 [Arabidopsis thaliana]	4.00001e-41	71%
RefSeq	Populus trichocarpa	XP_002301494.1	predicted protein [Populus trichocarpa]	1.99965e-42	72%

Full-Lengther Next Prediction

Fln status: Internal

Fln database: sp_plants

Fln subject: Q9SZL9

Fln msg: Distance to subject end: 555 aas, your sequence is shorter than subject: 92 - 1111

Fln protein: FKVRINSLPESIRRRSDAYNAHEEIRSKRAQIELGGDPTEPLKVLKATWMADGTHWPGTWISPDREHSRGDHPGIIQVMLAPPSSEPLMGCS

Protein Length: 93

Fln nts: GTTCAAGGTGAGGATCAATTCCTTGCCAGAATCTATCAGGAGAAGATCAGATGCTTACAATGCTCACGAAGAGATTCGTTCAAAGAGAGCACAGATTGAATTAGGAGGTGATCCTACAGAGCCACTGAAGGTATTGAAGGCTACATGGATGGCAGATGGGACTCACTGGCCTGGGACATGGATTTCCCCTGACAGAGAACATTCCAGGGGAGATCATCCGGGCATAATTCAGGTGATGTTGGCTCCTCCAAGCTCAGAACCTCTGATGGGATGCTCTGA

Fln Alignment:

GD4IA4402DDSW8___FKVRINSLPESIRRRSDAYNAHEEIRSKRAQIELGGDPTEPLKVLKATWMADGTHWPGTWISPDREHSRGDHPGIIQVMLAPPSSEPLMGCS
Q9SZL9_______________FKVRINGLPDSIRRRSDAFNAREEMKALKQMRESGGDPTEPVKVPKATWMADGTHWPGTWAASTREHSKGDHAGILQVMLKPPSSDPLIGNS

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain