UniGene Name: sp_v3.0_unigene75627
Length: 214 nt
![]() |
---|
>sp_v3.0_unigene75627
T |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | pentatricopeptide repeat-containing protein [Arabidopsis thaliana] sp|Q9FJY7.1|PP449_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At5g66520 dbj|BAB10928.1| selenium-binding protein-like [Arabidopsis thaliana] gb|AED98224.1| pentatricope | - | - | 2.0e-17 | 60% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 67% |
Sma3 | Pentatricopeptide repeat-containing protein, putative | - | - | 8.167e-07 | - |
Source | Gene names |
---|---|
Sma3 | At1g15510; At3g28640; At3g28660; At4g21300; At5g40410; At5g66520; GSVIVT00015527001; GSVIVT00016451001; GSVIVT00017804001; GSVIVT00021552001; GSVIVT00023808001; GSVIVT00024276001; GSVIVT00026118001; GSVIVT00029461001; GSVIVT00029859001; GSVIVT00031640001; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
Sma3 | methyltransferase activity | GO:0008168 | Molecular Function | 0.0 | - |
Sma3 | deaminase activity | GO:0019239 | Molecular Function | 0.0 | - |
Sma3 | metabolic process | GO:0008152 | Biological Process | 0.0 | - |
Sma3 | purine ribonucleoside monophosphate biosynthetic process | GO:0009168 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Adenosine/AMP deaminase domain | IPR001365 | - | 0.0 | - |
Sma3 | Pentatricopeptide repeat | IPR002885 | - | 0.0 | - |
Sma3 | Immunoglobulin/major histocompatibility complex, conserved site | IPR003006 | - | 0.0 | - |
Sma3 | Tetratricopeptide-like helical | IPR011990 | - | 0.0 | - |
Sma3 | Methyltransferase type 11 | IPR013216 | - | 0.0 | - |
Sma3 | Thioredoxin, conserved site | IPR017937 | - | 0.0 | - |
Sma3 | Asp/Glu racemase, active site | IPR018187 | - | 0.0 | - |
Sma3 | WD40 repeat, conserved site | IPR019775 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G66520.1 | Tetratricopeptide repeat (TPR)-like superfamily protein chr5:26551879-26553741 FORWARD LENGTH=620 | 1.0e-22 | 60% |
RefSeq | Arabidopsis thaliana | NP_201453.1 | pentatricopeptide repeat-containing protein [Arabidopsis thaliana] | 1.0e-22 | 60% |
RefSeq | Populus trichocarpa | XP_002331135.1 | predicted protein [Populus trichocarpa] | 2.0e-22 | 58% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5ADG9
Fln msg: Distance to subject end: 178 aas, your sequence is shorter than subject: 71 - 312
Fln protein:
F
Protein Length:
72
Fln nts:
T
Fln Alignment:
GD4IA4402DEESZ___FHCMTQDYQITPVMEHYSCLVDLLGRAGHLGDAYYFIQMMPLDPSADVWGALLGACRNYCNIELGENVAE
D5ADG9_______________YNCMTLDYAITPTVEHYACMVDLLGRAGHLNEAWDFIEKMPIEPGASVWGAFLGSCRIHCNIELGERVAE
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain