SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene75620

Length: 464 nt

UniGene Fasta

>sp_v3.0_unigene75620
AGAAATGCCCGTTTAAATGCAGGCAATGCCTTCCAGGATCTTTGGACTCAAAGAAAGTAAAGGGTAAAATAGTCTTCTGCCTAAGAGGAAATGGTACCAGAGTTGGGAAAGGCATAGAGGTGAAAAGGGCAGAAATATCAGTGGATGCATATTGTTCCAGCCCACACTGTCCTGGGAACCAGGCCAGCACCATTCATGGCCGCCTTCTCTTCCAGGGGCCCCAATTTGGTCAATCCAGACATCCTGAAGCCAGATATTACAGCACCTGGTCTGAATATACTGGCAGCCTGGAGTGGAGCAGCCTCTCCTACCAAGCTTTTAATGGATGATCGTCGTGTAAAGTACAATATTATCTCCGGCACATCAATGTCGTGCCCACATATTGCAGGAATAGCAGCCCTGTTAAAGGCAATTCATCCAAATTGGAGCCCTGCCGCTATCAAATCTGCCCTCATGACCACTGC

Ace file of the UniGene sp_v3.0_unigene75620

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	subtilisin-like protease [Arabidopsis thaliana]	-	-	1.0e-37	71%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	75%
Sma3	Subtilisin-like protease	-	-	7.56701e-44	-

Source	ECs	Term	Type	e value	Identity
Sma3	2-alkenal reductase.	EC:1.3.1.74	-	3.374e-07	-
Sma3	Cucumisin.	EC:3.4.21.25	-	5.732e-31	-

Source	Gene names
Sma3	A43; AIR3; ARA12; ASP48; AT3G14067; AT4g26330; AT4g34980; At1g01900; At1g04110; At2g04160; At2g05920; At3g14067; At3g14240; At4g26330; At4g34980; At5g45650; At5g45650/MRA19_5; At5g51750; At5g59100; At5g59810/mmn10_30; At5g67360; B0103C08-B0602B01.5; F20D2

Source	GOs	Term	Type	Identity
Sma3	cell wall	GO:0005618	Cellular Component	-
Sma3	vacuole	GO:0005773	Cellular Component	-
Sma3	plasma membrane	GO:0005886	Cellular Component	-
Sma3	plant-type cell wall	GO:0009505	Cellular Component	-
Sma3	external side of plasma membrane	GO:0009897	Cellular Component	-
Sma3	membrane	GO:0016020	Cellular Component	-
Sma3	extracellular matrix	GO:0031012	Cellular Component	-
Sma3	apoplast	GO:0048046	Cellular Component	-
Sma3	serine-type endopeptidase activity	GO:0004252	Molecular Function	-
Sma3	calcium ion binding	GO:0005509	Molecular Function	-
Sma3	identical protein binding	GO:0042802	Molecular Function	-
Sma3	proteolysis	GO:0006508	Biological Process	-
Sma3	double fertilization forming a zygote and endosperm	GO:0009567	Biological Process	-
Sma3	response to auxin stimulus	GO:0009733	Biological Process	-
Sma3	plant-type cell wall modification	GO:0009827	Biological Process	-
Sma3	lateral root morphogenesis	GO:0010102	Biological Process	-
Sma3	stomatal complex morphogenesis	GO:0010103	Biological Process	-
Sma3	regulation of cell proliferation	GO:0042127	Biological Process	-
Sma3	negative regulation of catalytic activity	GO:0043086	Biological Process	-
Sma3	mucilage metabolic process involved seed coat development	GO:0048359	Biological Process	-
Sma3	mucilage extrusion from seed coat	GO:0080001	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	C2 calcium-dependent membrane targeting	IPR000008	-	-
Sma3	Phosphofructokinase domain	IPR000023	-	-
Sma3	Ornithine/DAP/Arg decarboxylase	IPR000183	-	-
Sma3	Peptidase S8/S53, subtilisin/kexin/sedolisin	IPR000209	-	-
Sma3	RNA helicase, ATP-dependent, DEAD-box, conserved site	IPR000629	-	-
Sma3	SEC7-like	IPR000904	-	-
Sma3	Arf GTPase activating protein	IPR001164	-	-
Sma3	Protease-associated domain, PA	IPR003137	-	-
Sma3	Domain of unknown function DUF591	IPR007649	-	-
Sma3	Proteinase inhibitor I9	IPR010259	-	-
Sma3	TonB box, conserved site	IPR010916	-	-
Sma3	Reverse transcriptase, RNA-dependent DNA polymerase	IPR013103	-	-
Sma3	Peroxisome membrane protein, Pex16	IPR013919	-	-
Sma3	Peptidase S8, subtilisin-related	IPR015500	-	-
Sma3	Protein kinase, ATP binding site	IPR017441	-	-
Sma3	C2 membrane targeting protein	IPR018029	-	-
Sma3	Chromogranin, conserved site	IPR018054	-	-
Sma3	Peptidase S10, serine carboxypeptidase, active site	IPR018202	-	-
Sma3	Peroxidases heam-ligand binding site	IPR019793	-	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	AT5G67360.1	ARA12 Subtilase family protein chr5:26872192-26874465 REVERSE LENGTH=757	5.60519e-45	71%
RefSeq	Arabidopsis thaliana	NP_569048.1	subtilisin-like protease [Arabidopsis thaliana]	7.00649e-45	71%
RefSeq	Populus trichocarpa	XP_002317314.1	predicted protein [Populus trichocarpa]	5.04467e-44	72%

Full-Lengther Next Prediction

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: C0PPS1

Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 102 aas, your sequence is shorter than subject: 154 - 690

Fln protein: RNARLNAGNAFQDLWTQRK*RVK*SSA*EEMVPELGKA*R*KGQKYQWMHIVPAHTVLGTRPAPFMAAFSSRGPNLVNPDILKPDITAPGLNILAAWSGAASPTKLLMDDRRVKYNIISGTSMSCPHIAGIAALLKAIHPNWSPAAIKSALMTT

Protein Length: 155

Fln nts: AGAAATGCCCGTTTAAATGCAGGCAATGCCTTCCAGGATCTTTGGACTCAAAGAAAGTAAAGGGTAAAATAGTCTTCTGCCTAAGAGGAAATGGTACCAGAGTTGGGAAAGGCATAGAGGTGAAAAGGGCAGAAATATCAGTGGATGCATATTGTTCCAGCCCACACTGTCCTGGGAACCAGGCCAGCACCATTCATGGCCGCCTTCTCTTCCAGGGGCCCCAATTTGGTCAATCCAGACATCCTGAAGCCAGATATTACAGCACCTGGTCTGAATATACTGGCAGCCTGGAGTGGAGCAGCCTCTCCTACCAAGCTTTTAATGGATGATCGTCGTGTAAAGTACAATATTATCTCCGGCACATCAATGTCGTGCCCACATATTGCAGGAATAGCAGCCCTGTTAAAGGCAATTCATCCAAATTGGAGCCCTGCCGCTATCAAATCTGCCCTCATGACCACTGC

Fln Alignment:

GD4IA4402DPDVA___TVLGTRPAPFMAAFSSRGPNLVNPDILKPDITAPGLNILAAWSGAASPTKLLMDDRRVKYNIISGTSMSCPHIAGIAALLKAIHPNWSPAAIKSALMTT
C0PPS1_______________TVLGVKPSPVVAAFSSRGPNLVNPEILKPDMIAPGLNILAAWTGITGPTGLSDDLRRVKFNILSGTSMSCPHVTGIAALMKGAHPEWSPAAIKSALMTT

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain