|
||||||
|
UniGene Name: sp_v3.0_unigene75608
Length: 160 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
 UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene75608
G |
|
Ace file of the UniGene sp_v3.0_unigene75608 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Phytochrome n=43 Tax=Spermatophyta RepID=PHY_PINSY | - | - | 7.0e-18 | 97% |
| FL-Next | sp=Phytochrome; Pinus sylvestris (Scots pine). | - | - | 0.0 | 97% |
| Sma3 | Phytochrome | - | - | 5.974e-17 | - |
| Source | Gene names |
|---|---|
| Sma3 | CpPHY2; PHY; PHY1; PHY2; PHY3; PHY4; PHY5a; PHY5b; PHY5c; PHYB; PHYB1; PHYD; PHYP; PHYPADRAFT_115388; PHYPADRAFT_165601; PHYPADRAFT_185248; PHYPADRAFT_208532; PHYPADRAFT_218861; PHYPADRAFT_225644; PHYPADRAFT_65134; PhyMpd; phy1; phy2; phy3; phy4; phyo; ph |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | two-component sensor activity | GO:0000155 | Molecular Function | 0.0 | - |
| Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | G-protein coupled photoreceptor activity | GO:0008020 | Molecular Function | 0.0 | - |
| Sma3 | protein homodimerization activity | GO:0042803 | Molecular Function | 0.0 | - |
| Sma3 | two-component signal transduction system (phosphorelay) | GO:0000160 | Biological Process | 0.0 | - |
| Sma3 | regulation of transcription, DNA-dependent | GO:0006355 | Biological Process | 0.0 | - |
| Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
| Sma3 | signal transduction | GO:0007165 | Biological Process | 0.0 | - |
| Sma3 | sensory perception | GO:0007600 | Biological Process | 0.0 | - |
| Sma3 | red, far-red light phototransduction | GO:0009585 | Biological Process | 0.0 | - |
| Sma3 | protein-tetrapyrrole linkage | GO:0017006 | Biological Process | 0.0 | - |
| Sma3 | peptidyl-histidine phosphorylation | GO:0018106 | Biological Process | 0.0 | - |
| Sma3 | protein-chromophore linkage | GO:0018298 | Biological Process | 0.0 | - |
| Sma3 | response to stimulus | GO:0050896 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | PAS | IPR000014 | - | 0.0 | - |
| Sma3 | PAS-associated, C-terminal | IPR000700 | - | 0.0 | - |
| Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
| Sma3 | Phytochrome | IPR001294 | - | 0.0 | - |
| Sma3 | PAC motif | IPR001610 | - | 0.0 | - |
| Sma3 | GAF domain | IPR003018 | - | 0.0 | - |
| Sma3 | ATPase-like, ATP-binding domain | IPR003594 | - | 0.0 | - |
| Sma3 | Signal transduction histidine kinase, subgroup 1, dimerisation/phosphoacceptor domain | IPR003661 | - | 0.0 | - |
| Sma3 | Signal transduction histidine kinase, core | IPR005467 | - | 0.0 | - |
| Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
| Sma3 | Phytochrome A/B/C/D/E | IPR012129 | - | 0.0 | - |
| Sma3 | Phytochrome, central region | IPR013515 | - | 0.0 | - |
| Sma3 | Phytochrome chromophore binding site | IPR013516 | - | 0.0 | - |
| Sma3 | PAS fold-2 | IPR013654 | - | 0.0 | - |
| Sma3 | PAS fold | IPR013767 | - | 0.0 | - |
| Sma3 | Phytochrome chromophore attachment domain | IPR016132 | - | 0.0 | - |
| Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
| Sma3 | IPR017442 | - | 0.0 | - | |
| Sma3 | WD40 repeat, conserved site | IPR019775 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT2G18790.1 | PHYB, HY3, OOP1 phytochrome B chr2:8140079-8144151 FORWARD LENGTH=1172 | 3.0e-11 | 59% |
| RefSeq | Arabidopsis thaliana | NP_179469.1 | phytochrome B [Arabidopsis thaliana] | 4.0e-11 | 59% |
| RefSeq | Populus trichocarpa | XP_002312330.1 | predicted protein [Populus trichocarpa] | 5.0e-13 | 61% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: Q41046
Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 409 aas, your sequence is shorter than subject: 53 - 1131
Fln protein:
K
Protein Length:
54
Fln nts:
G
Fln Alignment:
GD4IA4402C9N21___ESVERVEKMLHNALRGEEEKNVEMMLKTFGPQKEKEAVILVVNACSS
Q41046_______________QSVERVEKMLHNALRGEEEKNVEMMLKTFGPQKEKEAVILVVNACSS
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
