UniGene Name: sp_v3.0_unigene75587
Length: 204 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
![]() |
---|
>sp_v3.0_unigene75587
G |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Pentatricopeptide repeat protein (Fragment) n=1 Tax=Lepidogyna hodgsoniae RepID=B3U1Z4_9MARC | - | - | 2.0e-21 | 75% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 73% |
Sma3 | Pentatricopeptide repeat protein | - | - | 0.0 | - |
Source | Gene names |
---|---|
Sma3 | At1g25360; At1g47580; At1g56690; At2g03880; At2g15690; At2g22070; At2g27610; At3g13770; At3g26782; At3g61170; At4g16835; At4g33170; At4g33990; At5g16860; At5g52630; DYW10; EMB2758; F10A12.28; F15K20.29; F16N3.14; F17I5.180; F25P12.87; F2K13_10; F3O9.28; F |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
Sma3 | ribosome | GO:0005840 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
Sma3 | structural constituent of ribosome | GO:0003735 | Molecular Function | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | DNA methylation | GO:0006306 | Biological Process | 0.0 | - |
Sma3 | translation | GO:0006412 | Biological Process | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | thiamine biosynthetic process | GO:0009228 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Peptidase S8/S53, subtilisin/kexin/sedolisin | IPR000209 | - | 0.0 | - |
Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
Sma3 | Ribosomal protein S3, C-terminal | IPR001351 | - | 0.0 | - |
Sma3 | C-5 cytosine methyltransferase | IPR001525 | - | 0.0 | - |
Sma3 | Thiamine biosynthesis protein ThiC | IPR002817 | - | 0.0 | - |
Sma3 | Pentatricopeptide repeat | IPR002885 | - | 0.0 | - |
Sma3 | MAP kinase, conserved site | IPR003527 | - | 0.0 | - |
Sma3 | K Homology domain, type 2 | IPR004044 | - | 0.0 | - |
Sma3 | K Homology domain | IPR004087 | - | 0.0 | - |
Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
Sma3 | Tetratricopeptide-like helical | IPR011990 | - | 0.0 | - |
Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
Sma3 | IPR017442 | - | 0.0 | - | |
Sma3 | IPR018115 | - | 0.0 | - | |
Sma3 | Asp/Glu racemase, active site | IPR018187 | - | 0.0 | - |
Sma3 | EF-Hand 1, calcium-binding site | IPR018247 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G47580.1 | Pentatricopeptide repeat (PPR) superfamily protein chr1:17485668-17486387 FORWARD LENGTH=239 | 3.0e-26 | 70% |
RefSeq | Arabidopsis thaliana | NP_175189.2 | putative lipoyltransferase [Arabidopsis thaliana] | 4.0e-26 | 70% |
RefSeq | Populus trichocarpa | XP_002326908.1 | predicted protein [Populus trichocarpa] | 2.0e-24 | 68% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9P0W0
Fln msg: Distance to subject end: 34 aas, your sequence is shorter than subject: 67 - 370
Fln protein:
E
Protein Length:
68
Fln nts:
G
Fln Alignment:
GFIJCBT03F3OGL___KDAGYVPDTSFVLHDVDQEQKEIKLSHHSEKLAIAFGLISTPIEETIQVFKNLRICGDCH
A9P0W0_______________KAAGYIPNTNFVLHDVEEEQKEWILGHHSEKLAIAFGIISTPPGTTIRVVKNLRVCGDCH
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain