UniGene Name: sp_v3.0_unigene75581
Length: 179 nt
![]() |
---|
>sp_v3.0_unigene75581
C |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Ribonuclease III, putative n=1 Tax=Ricinus communis RepID=B9RQZ1_RICCO | - | - | 1.0e-16 | 69% |
FL-Next | sp=Endoribonuclease Dicer homolog 3; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 61% |
Source | Gene names |
---|---|
Sma3 | At3g43920; DCL904; GSVIVT00032302001; POPTRDRAFT_260546; RCOM_0707850; T15B3_60; VITISV_035236; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | intracellular | GO:0005622 | Cellular Component | 0.0 | - |
Sma3 | nucleolus | GO:0005730 | Cellular Component | 0.0 | - |
Sma3 | nucleic acid binding | GO:0003676 | Molecular Function | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | double-stranded RNA binding | GO:0003725 | Molecular Function | 0.0 | - |
Sma3 | helicase activity | GO:0004386 | Molecular Function | 0.0 | - |
Sma3 | ribonuclease III activity | GO:0004525 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | ATP-dependent helicase activity | GO:0008026 | Molecular Function | 0.0 | - |
Sma3 | RNA processing | GO:0006396 | Biological Process | 0.0 | - |
Sma3 | maintenance of DNA methylation | GO:0010216 | Biological Process | 0.0 | - |
Sma3 | production of ta-siRNAs involved in RNA interference | GO:0010267 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Ribonuclease III domain | IPR000999 | - | 0.0 | - |
Sma3 | Double-stranded RNA-binding | IPR001159 | - | 0.0 | - |
Sma3 | Helicase, C-terminal | IPR001650 | - | 0.0 | - |
Sma3 | Pentatricopeptide repeat | IPR002885 | - | 0.0 | - |
Sma3 | Argonaute/Dicer protein, PAZ | IPR003100 | - | 0.0 | - |
Sma3 | Dicer double-stranded RNA-binding fold | IPR005034 | - | 0.0 | - |
Sma3 | Phosphopantetheine attachment site | IPR006162 | - | 0.0 | - |
Sma3 | Helicase/UvrB domain | IPR006935 | - | 0.0 | - |
Sma3 | DNA/RNA helicase, DEAD/DEAH box type, N-terminal | IPR011545 | - | 0.0 | - |
Sma3 | Tetratricopeptide-like helical | IPR011990 | - | 0.0 | - |
Sma3 | Helicase, superfamily 1/2, ATP-binding domain | IPR014001 | - | 0.0 | - |
Sma3 | IPR014021 | - | 0.0 | - | |
Sma3 | Extracellular solute-binding protein, family 3, conserved site | IPR018313 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT3G43920.2 | DCL3, ATDCL3 dicer-like 3 chr3:15753548-15760830 FORWARD LENGTH=1580 | 1.0e-16 | 61% |
RefSeq | Arabidopsis thaliana | NP_001154663.2 | protein dicer-like 3 [Arabidopsis thaliana] | 2.0e-16 | 61% |
RefSeq | Populus trichocarpa | XP_002324204.1 | dicer-like protein, partial [Populus trichocarpa] | 4.0e-16 | 59% |
![]() |
---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q9LXW7
Fln msg: Distance to subject end: 1425 aas, your sequence is shorter than subject: 59 - 1580
Fln protein:
T
Protein Length:
60
Fln nts:
C
Fln Alignment:
GFIJCBT03FKN6V___TVSLVEQQFEVIKLNSHFKVAEYFGAKGVDNWTIDKWTVEINSHEVLVMTPQILLDALR
Q9LXW7_______________TVNLVKQQCCEIRALVNLKVEEYFGAKGVDKWTSQRWDEEFSKHDVLVMTPQILLDVLR
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain