UniGene Name: sp_v3.0_unigene75568
Length: 194 nt
UniGene Fasta |
---|
>sp_v3.0_unigene75568
C |
Ace file of the UniGene sp_v3.0_unigene75568 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | putative pre-mRNA-splicing factor ATP-dependent RNA helicase [Arabidopsis thaliana] sp|O22899.1|DHX15_ARATH RecName: Full=Probable pre-mRNA-splicing factor ATP-dependent RNA helicase gb|AAB63825.1| putative pre-mRNA splicing factor RNA helicase [Arabidops | - | - | 2.0e-18 | 87% |
FL-Next | sp=Probable pre-mRNA-splicing factor ATP-dependent RNA helicase; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 83% |
Sma3 | ATP-dependent RNA helicase, putative | - | - | 2.12e-09 | - |
Source | Gene names |
---|---|
Sma3 | AT4g16680; At2g47250; At3g26560; GSVIVT00028144001; GSVIVT00033641001; MFE16.8; MICPUCDRAFT_24785; MICPUN_51830; MICPUN_58037; OSJNBa0010K08.27; OSTLU_12120; Os02g0301500; OsI_06862; OsJ_06372; Ot01g03060; PHATRDRAFT_23865; PHATRDRAFT_51921; PHYPADRAFT_17 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
Sma3 | chloroplast envelope | GO:0009941 | Cellular Component | 0.0 | - |
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | nucleic acid binding | GO:0003676 | Molecular Function | 0.0 | - |
Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
Sma3 | helicase activity | GO:0004386 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | ATP-dependent helicase activity | GO:0008026 | Molecular Function | 0.0 | - |
Sma3 | mRNA processing | GO:0006397 | Biological Process | 0.0 | - |
Sma3 | RNA splicing | GO:0008380 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Helicase, C-terminal | IPR001650 | - | 0.0 | - |
Sma3 | DNA/RNA helicase, ATP-dependent, DEAH-box type, conserved site | IPR002464 | - | 0.0 | - |
Sma3 | Ribosomal protein S1, RNA-binding domain | IPR003029 | - | 0.0 | - |
Sma3 | AAA+ ATPase domain | IPR003593 | - | 0.0 | - |
Sma3 | Helicase-associated domain | IPR007502 | - | 0.0 | - |
Sma3 | Domain of unknown function DUF1605 | IPR011709 | - | 0.0 | - |
Sma3 | Nucleic acid-binding, OB-fold | IPR012340 | - | 0.0 | - |
Sma3 | Helicase, superfamily 1/2, ATP-binding domain | IPR014001 | - | 0.0 | - |
Sma3 | IPR014021 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT2G47250.1 | RNA helicase family protein chr2:19399923-19402981 REVERSE LENGTH=729 | 1.0e-20 | 87% |
RefSeq | Arabidopsis thaliana | NP_182247.1 | putative pre-mRNA-splicing factor ATP-dependent RNA helicase [Arabidopsis thaliana] | 2.0e-20 | 87% |
RefSeq | Populus trichocarpa | XP_002301528.1 | predicted protein [Populus trichocarpa] | 8.0e-21 | 87% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: sp_plants
Fln subject: O22899
Fln msg: Warning!, your query overlaps and the subject is separated, Distance to subject end: 359 aas, your sequence is shorter than subject: 65 - 729
Fln protein:
P
Protein Length:
66
Fln nts:
C
Fln Alignment:
GFIJCBT03HHIXE___NLITQVGPVKAVPLYSTLPPAMQQKIFELAPxxLNGGGPPGRKVVVSTNIAETSLTIDGIVYVIDP
O22899_______________NLGDQVGPVKVVPLYSTLPPAMQQKIFDPAPxxLTEGGPAGRKIVVSTNIAETSLTIDGIVYVIDP
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain